Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_1 In blautia CP039126.1
Seq (len = 70 ):
MRRHKEPEVRKGELLDAAQKLFVEKGYAKTTVTDILNVHGLSKGVFYYYFKSKEEVMDAIIQRMVDDMVD
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|53272|1|1378300-1378576
Transkriptom
87.0% of gene length expressed over median expression of contig.
ŝ
9.448550002027124
unique PSMS
15
unique PSMS
15
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
TetR/AcrR family transcriptional regulator [Clostridiales bacterium VE202-06]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
TetR/AcrR family transcriptional regulator [Clostridiales bacterium VE202-06] |
1.36e-42 | 100 | 100.000 | WP_029468023 |
TetR/AcrR family transcriptional regulator [Blautia producta] HTH-type transcriptional repressor KstR2 [Blautia producta] |
1.48e-42 | 100 | 100.000 | WP_018594525 |
TetR/AcrR family transcriptional regulator [Blautia coccoides] TetR family transcriptional regulator [Blautia coccoides] transcriptional regulator [Blautia coccoides] |
1.02e-41 | 99 | 100.000 | WP_115623326 |
TetR/AcrR family transcriptional regulator [Clostridium transplantifaecale] |
1.31e-41 | 100 | 98.571 | WP_125142317 |
TetR/AcrR family transcriptional regulator [Clostridium sp. chh4-2] TetR/AcrR family transcriptional regulator [Clostridium sp. chh4-2] |
1.41e-39 | 100 | 94.286 | WP_103230127 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [unclassified Clostridiales (miscellaneous)] TetR/AcrR family transcriptional regulator [Clostridiales bacterium TF09-2AC] |
1.45e-38 | 99 | 95.652 | WP_040381653 |
TetR/AcrR family transcriptional regulator [Lachnoclostridium pacaense] |
1.5e-38 | 99 | 95.652 | WP_081739075 |
transcriptional regulator, TetR family [Clostridiales bacterium 1_7_47FAA] |
1.52e-38 | 99 | 95.652 | EEQ59412 |
TetR/AcrR family transcriptional regulator [Kineothrix alysoides] TetR family transcriptional regulator [Kineothrix alysoides] |
1.04e-36 | 100 | 88.571 | WP_031390727 |
TetR/AcrR family transcriptional regulator [Clostridioides difficile] TetR family transcriptional regulator [Clostridioides difficile] |
4.11e-23 | 100 | 62.857 | WP_054270301 |
TetR/AcrR family transcriptional regulator [Clostridioides difficile] TetR family transcriptional regulator [Clostridioides difficile] HTH-type transcriptional repressor KstR2 [Clostridioides difficile] HTH-type transcriptional repressor KstR2 [Clostridioides difficile] |
4.16e-23 | 100 | 62.857 | WP_054276700 |
TetR/AcrR family transcriptional regulator [Clostridioides difficile] TetR family transcriptional regulator [Clostridioides difficile] |
4.2e-23 | 100 | 64.286 | WP_054273813 |
TetR/AcrR family transcriptional regulator [Clostridioides difficile] |
4.53e-23 | 100 | 64.286 | WP_107594809 |
TetR/AcrR family transcriptional regulator [Bacillus sp. FJAT-45385] |
1.24e-22 | 94 | 66.667 | WP_088102941 |
TetR/AcrR family transcriptional regulator [Clostridioides difficile] bacterial regulatory s, tetR family protein [Clostridioides difficile CD160] |
1.28e-22 | 100 | 61.429 | WP_021384610 |
TetR/AcrR family transcriptional regulator [Paenibacillus ihuae] |
2.14e-22 | 99 | 63.768 | WP_054941220 |
TetR/AcrR family transcriptional regulator [Paenibacillus daejeonensis] |
3.56e-22 | 94 | 66.667 | WP_020618352 |
TetR/AcrR family transcriptional regulator [Clostridium sp. AM58-1XD] TetR/AcrR family transcriptional regulator [Clostridium sp. AM58-1XD] |
4.31e-22 | 93 | 66.154 | WP_118241308 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
5.06e-22 | 100 | 62.857 | WP_076120727 |
TetR/AcrR family transcriptional regulator [Clostridium sp.] |
6.15e-22 | 93 | 67.692 | HAG45117 |
TetR/AcrR family transcriptional regulator [Clostridium argentinense] TetR family transcriptional regulator [Clostridium argentinense] bacterial regulatory s, tetR family protein [Clostridium argentinense CDC 2741] |
6.56e-22 | 94 | 66.667 | WP_039633906 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. FSL R5-0345] TetR family transcriptional regulator [Paenibacillus sp. FSL R5-0345] |
1.67e-21 | 100 | 61.429 | WP_042129296 |
TetR family transcriptional regulator [Paenibacillus sp. py1325] |
2.26e-21 | 99 | 65.217 | WP_139991813 |
transcriptional regulator, TetR family [Paenibacillus uliginis N3/975] |
3.75e-21 | 100 | 60.000 | SMF86868 |
TetR/AcrR family transcriptional regulator [Bacillus fortis] TetR/AcrR family transcriptional regulator [Bacillus fortis] |
4.04e-21 | 100 | 61.429 | WP_120068898 |
TetR/AcrR family transcriptional regulator [Paenibacillus dendritiformis] TetR/AcrR family transcriptional regulator [Paenibacillus dendritiformis] |
4.26e-21 | 94 | 62.121 | WP_111154791 |
TetR/AcrR family transcriptional regulator [Paenibacillus dendritiformis] TetR family transcriptional regulator [Paenibacillus dendritiformis C454] |
4.59e-21 | 94 | 62.121 | WP_006677426 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Paenibacillaceae] HTH-type transcriptional repressor KstR2 [Chlamydia abortus] |
5.86e-21 | 94 | 62.121 | WP_144938151 |
TetR family transcriptional regulator [Paenibacillus luteus] |
6.67e-21 | 99 | 63.768 | WP_141505123 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [unclassified Bacillus] DNA-binding transcriptional regulator, AcrR family [Bacillus sp. 71mf] DNA-binding transcriptional regulator, AcrR family [Bacillus sp. 103mf] |
8.85e-21 | 94 | 68.182 | WP_090912894 |
TetR/AcrR family transcriptional regulator [Paenibacillus pinisoli] TetR/AcrR family transcriptional regulator [Paenibacillus pinisoli] |
9.25e-21 | 100 | 60.000 | WP_120112893 |
TetR/AcrR family transcriptional regulator [Bacillus terrae] TetR/AcrR family transcriptional regulator [Bacillus terrae] |
9.43e-21 | 100 | 61.429 | WP_120119325 |
TetR/AcrR family transcriptional regulator [Bacillus sp. FJAT-27264] TetR family transcriptional regulator [Bacillus sp. FJAT-27264] |
1.02e-20 | 94 | 63.636 | WP_066362647 |
TetR/AcrR family transcriptional regulator [Paenibacillus algorifonticola] transcriptional regulator, TetR family [Paenibacillus algorifonticola] |
1.13e-20 | 93 | 67.692 | WP_046232051 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. 1011MAR3C5] TetR/AcrR family transcriptional regulator [Paenibacillus sp. 1011MAR3C5] |
2.71e-20 | 100 | 60.000 | WP_119799103 |
TetR/AcrR family transcriptional regulator [Pueribacillus theae] TetR/AcrR family transcriptional regulator [Pueribacillus theae] |
2.72e-20 | 100 | 57.143 | WP_116555217 |
TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] |
3.05e-20 | 94 | 66.667 | WP_098719289 |
TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] |
3.18e-20 | 94 | 66.667 | WP_098018842 |
MULTISPECIES: TetR family transcriptional regulator [Bacillus] |
3.24e-20 | 100 | 60.000 | WP_144463029 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Bacillus] TetR family transcriptional regulator [Bacillus pseudomycoides DSM 12442] bacterial regulatory s, tetR family protein [Bacillus pseudomycoides] bacterial regulatory s, tetR family protein [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] |
3.25e-20 | 94 | 66.667 | WP_006094853 |
TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] |
3.43e-20 | 94 | 66.667 | WP_097787246 |
TetR/AcrR family transcriptional regulator [Bacillus sp. 105MF] |
3.47e-20 | 94 | 66.667 | WP_018767047 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp.] |
3.48e-20 | 100 | 60.000 | HBS43891 |
TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] |
3.51e-20 | 94 | 66.667 | WP_098206108 |
TetR/AcrR family transcriptional regulator [Bacillus sp. FJAT-44876] |
3.59e-20 | 94 | 56.061 | WP_096187075 |
TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] |
3.78e-20 | 94 | 66.667 | WP_003207186 |
TetR/AcrR family transcriptional regulator [Sebaldella termitidis] transcriptional regulator, TetR family [Sebaldella termitidis ATCC 33386] HTH-type transcriptional repressor KstR2 [Sebaldella termitidis] |
4.47e-20 | 94 | 62.121 | WP_012862593 |
TetR/AcrR family transcriptional regulator [Marinisporobacter balticus] TetR family transcriptional regulator [Marinisporobacter balticus] |
4.74e-20 | 94 | 65.152 | WP_132246865 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
5.64e-20 | 100 | 60.000 | WP_076286591 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. FSL H7-0737] TetR family transcriptional regulator [Paenibacillus sp. FSL H7-0737] |
5.64e-20 | 100 | 60.000 | WP_042189879 |
TetR/AcrR family transcriptional regulator [Clostridium sp.] |
5.75e-20 | 93 | 67.692 | HCQ89724 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. BIHB4019] TetR family transcriptional regulator [Paenibacillus sp. BIHB4019] |
5.87e-20 | 93 | 66.154 | WP_099519942 |
TetR family transcriptional regulator [Paenibacillus sp. B2(2019)] TetR/AcrR family transcriptional regulator [Paenibacillus sp. B2(2019)] |
5.89e-20 | 100 | 60.000 | WP_149646917 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. 598K] TetR family transcriptional regulator [Paenibacillus sp. 598K] |
5.91e-20 | 94 | 63.636 | WP_128659648 |
TetR/AcrR family transcriptional regulator [[Clostridium] clostridioforme] TetR family transcriptional regulator [[Clostridium] clostridioforme 90A7] |
6.43e-20 | 93 | 64.615 | WP_002591498 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Bacillus] TetR family transcriptional regulator [Bacillus sp. AFS098217] TetR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus sp. AFS019443] TetR family transcriptional regulator [Bacillus sp. AFS014408] TetR family transcriptional regulator [Bacillus sp. AFS075034] |
6.54e-20 | 94 | 65.152 | WP_097897962 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. Leaf72] TetR family transcriptional regulator [Paenibacillus sp. Leaf72] |
6.54e-20 | 93 | 66.154 | WP_056028776 |
TetR/AcrR family transcriptional regulator [Bacillus australimaris] TetR family transcriptional regulator [Bacillus australimaris] |
6.58e-20 | 99 | 61.429 | WP_060698856 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Clostridiales] TetR family transcriptional regulator [[Clostridium] bolteae 90B3] TetR family transcriptional regulator [[Clostridium] bolteae 90A9] TetR/AcrR family transcriptional regulator [[Clostridium] clostridioforme] TetR/AcrR family transcriptional regulator [Hungatella hathewayi] |
6.78e-20 | 93 | 64.615 | WP_002574179 |
TetR/AcrR family transcriptional regulator [Anaerobacillus alkalidiazotrophicus] TetR family transcriptional regulator [Anaerobacillus alkalidiazotrophicus] |
6.99e-20 | 100 | 58.571 | WP_071388138 |
TetR/AcrR family transcriptional regulator [Paenibacillus borealis] TetR family transcriptional regulator [Paenibacillus borealis] |
7.35e-20 | 94 | 59.091 | WP_076112412 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
7.54e-20 | 94 | 62.121 | WP_076134330 |
TetR/AcrR family transcriptional regulator [Bacillus safensis] TetR family transcriptional regulator [Bacillus safensis] TetR family transcriptional regulator [Bacillus safensis] TetR family transcriptional regulator [Bacillus safensis] |
8.07e-20 | 96 | 61.194 | WP_048237944 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [unclassified Cohnella] TetR family transcriptional regulator [Cohnella sp. CIP 111063] TetR family transcriptional regulator [Cohnella sp. SGD-V74] |
8.11e-20 | 100 | 55.714 | WP_094041899 |
TetR/AcrR family transcriptional regulator [Paenibacillus etheri] TetR family transcriptional regulator [Paenibacillus etheri] |
8.57e-20 | 100 | 60.000 | WP_060622846 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. VTT E-133291] TetR family transcriptional regulator [Paenibacillus sp. VTT E-133291] |
9.65e-20 | 94 | 62.121 | WP_094875594 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Paenibacillus] TetR family transcriptional regulator [Paenibacillus sp. FSL H8-237] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.15e-19 | 94 | 60.606 | WP_036688975 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.15e-19 | 94 | 60.606 | WP_076201440 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.17e-19 | 94 | 60.606 | WP_111504771 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. FSL H7-0357] |
1.21e-19 | 94 | 59.091 | WP_052092176 |
TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] |
1.26e-19 | 94 | 65.152 | WP_098784574 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.28e-19 | 94 | 60.606 | WP_076105260 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.3e-19 | 94 | 60.606 | WP_038572259 |
TetR/AcrR family transcriptional regulator [Bacillus zeae] TetR/AcrR family transcriptional regulator [Bacillus zeae] |
1.31e-19 | 94 | 68.182 | WP_119112135 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.32e-19 | 94 | 60.606 | WP_076141075 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.32e-19 | 94 | 60.606 | WP_076147515 |
TetR/AcrR family transcriptional regulator [Paenibacillus ihumii] |
1.33e-19 | 94 | 60.606 | WP_055106774 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.33e-19 | 94 | 60.606 | WP_094902955 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.35e-19 | 94 | 60.606 | WP_076100184 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.38e-19 | 94 | 60.606 | WP_076129871 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
1.39e-19 | 94 | 60.606 | WP_076278735 |
TetR/AcrR family transcriptional regulator [Lysinibacillus meyeri] |
1.47e-19 | 94 | 60.606 | WP_107841063 |
TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR family transcriptional regulator [Bacillus pseudomycoides] bacterial regulatory s, tetR family protein [Bacillus pseudomycoides] TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] TetR/AcrR family transcriptional regulator [Bacillus pseudomycoides] |
1.68e-19 | 94 | 65.152 | WP_003197726 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Bacillus altitudinis complex] TetR family transcriptional regulator [Bacillus altitudinis] TetR family transcriptional regulator [Bacillus altitudinis] TetR family transcriptional regulator [Bacillus altitudinis] |
1.8e-19 | 93 | 61.538 | WP_039962849 |
TetR/AcrR family transcriptional regulator [Bacillus sp. Leaf49] TetR family transcriptional regulator [Bacillus sp. Leaf49] |
1.84e-19 | 93 | 61.538 | WP_056703970 |
TetR family transcriptional regulator [Paenibacillus sp. NEAU-GSW1] TetR family transcriptional regulator [Paenibacillus sp. NEAU-GSW1] |
1.89e-19 | 100 | 58.571 | WP_156284467 |
TetR/AcrR family transcriptional regulator [Paenibacillus donghaensis] TetR family transcriptional regulator [Paenibacillus donghaensis] |
1.94e-19 | 90 | 62.500 | WP_087920318 |
TetR/AcrR family transcriptional regulator [Bacillus altitudinis] |
1.96e-19 | 93 | 61.538 | WP_019743642 |
TetR family transcriptional regulator [Bacillus altitudinis] |
1.99e-19 | 93 | 61.538 | WP_144625462 |
TetR/AcrR family transcriptional regulator [Bacillus altitudinis] TetR family transcriptional regulator [Bacillus altitudinis] TetR/AcrR family transcriptional regulator [Bacillus sp. (in: Bacteria)] |
1.99e-19 | 93 | 61.538 | WP_039164921 |
TetR/AcrR family transcriptional regulator [Bacillus sp. L_1B0_12] TetR family transcriptional regulator [Bacillus sp. L_1B0_12] |
2.01e-19 | 93 | 61.538 | WP_046527534 |
TetR/AcrR family transcriptional regulator [Bacillus pumilus] |
2.03e-19 | 93 | 61.538 | WP_024720453 |
TetR family transcriptional regulator [Bacillus sp. HR216] |
2.03e-19 | 93 | 61.538 | WP_156061182 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Bacillus] TetR family transcriptional regulator [Bacillus sp. AN2] TetR/AcrR family transcriptional regulator [Streptococcus pneumoniae] Transcriptional regulator, TetR family [Bacillus sp. 348] TetR family transcriptional regulator [Bacillus pumilus] TetR family transcriptional regulator [Bacillus altitudinis] |
2.05e-19 | 93 | 61.538 | WP_008347371 |
TetR/AcrR family transcriptional regulator [Paenibacillus sp. VTT E-133280] TetR family transcriptional regulator [Paenibacillus sp. VTT E-133280] |
2.09e-19 | 100 | 60.000 | WP_094873444 |
MULTISPECIES: TetR/AcrR family transcriptional regulator [Bacillus] TetR family transcriptional regulator [Bacillus altitudinis 41KF2b] TetR family transcriptional regulator [Bacillus altitudinis] TetR family transcriptional regulator [Bacillus altitudinis] TetR family transcriptional regulator [Bacillus pumilus] TetR family transcriptional regulator [Bacillus altitudinis] |
2.09e-19 | 93 | 61.538 | WP_035703974 |
TetR/AcrR family transcriptional regulator [Bacillus altitudinis] |
2.14e-19 | 93 | 61.538 | WP_041092653 |
TetR/AcrR family transcriptional regulator [Aneurinibacillus migulanus] TetR family transcriptional regulator [Aneurinibacillus migulanus] TetR family transcriptional regulator [Aneurinibacillus migulanus] TetR family transcriptional regulator [Aneurinibacillus migulanus] transcriptional regulator, TetR family [Aneurinibacillus migulanus] |
2.21e-19 | 96 | 62.687 | WP_043063411 |
TetR/AcrR family transcriptional regulator [Aneurinibacillus migulanus] TetR family transcriptional regulator [Aneurinibacillus migulanus] TetR family transcriptional regulator [Aneurinibacillus migulanus] TetR family transcriptional regulator [Aneurinibacillus migulanus] |
2.26e-19 | 96 | 62.687 | WP_043070250 |
TetR/AcrR family transcriptional regulator [Paenibacillus odorifer] TetR family transcriptional regulator [Paenibacillus odorifer] |
2.28e-19 | 100 | 58.571 | WP_076300513 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_2 In ecoli U00096.3
Seq (len = 255 ):
MNDVPAKARNIAMVFQNYALYPHMTVYDNMAFGLKMQKIAKEVIDERVNWAAQILGLREYLKRKPGALSGGQRQRVALGRAIVREAGVFLMDEPLSNLDAKLRVQMRAEISKLHQKLNTTMIYVTHDQTEAMTMATRIVIMKDGIVQQVGAPKTVYNQPANMFVSGFIGSPAMNFIRGTIDGDKFVTETLKLTIPEEKLAVLKTQESLHKPIVMGIRPEDIHPDAQEENNISAKISVAELTGAEFMLYTTVGGTS
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|51165|1|1380730-1381786
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
9.459795700157938
unique PSMS
7
unique PSMS
7
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
orfx protein; similar to MalK and other inner membrane ATP binding transport proteins [Escherichia coli K-12]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
orfx protein; similar to MalK and other inner membrane ATP binding transport proteins [Escherichia coli K-12] |
0.0 | 100 | 100.000 | AAC34719 |
sn-glycerol-3-phosphate import ATP-binding protein UgpC [Escherichia coli] putative sugar transport protein [Escherichia coli XH001] putative sugar transporter subunit [Escherichia coli J53] sugar transporter subunit [Escherichia coli S17] putative sugar transporter subunit [Escherichia coli NCTC 50110] putative uncharacterized ABC transporter ATP-binding protein YcjV [Escherichia coli KRX] predicted sugar transporter subunit [Escherichia coli str. K-12 substr. W3110] predicted sugar transporter subunit [Escherichia coli DH1] predicted sugar transporter subunit [Escherichia coli str. K-12 substr. MDS42] |
0.0 | 100 | 100.000 | APQ21778 |
sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 100 | 100.000 | VTQ22525 |
maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3632-1] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 100 | 99.216 | EQZ53327 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_074579011 |
sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 100 | 99.608 | STM39242 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 99 | 100.000 | WP_053887316 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter family protein [Escherichia coli 2-052-05_S4_C3] ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_032187354 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_130068486 |
sugar ABC transporter ATP-binding protein [Shigella sp.] |
0.0 | 99 | 100.000 | HCG18859 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] |
0.0 | 99 | 100.000 | MQI19591 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_053289974 |
ABC transporter ATP-binding protein, partial [Escherichia coli] lactose ABC transporter, ATP-binding protein LacK, partial [Escherichia coli 909945-2] |
0.0 | 99 | 100.000 | WP_023157078 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_088542806 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_113854274 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter family protein [Escherichia coli 3-373-03_S1_C2] ABC transporter family protein [Escherichia coli 3-373-03_S1_C3] ABC transporter family protein [Escherichia coli 3-373-03_S1_C1] |
0.0 | 99 | 100.000 | WP_032253422 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_113391507 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_112922637 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_134274964 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_089568711 |
ABC transporter ATP-binding protein [Escherichia coli] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE119] |
0.0 | 99 | 100.000 | WP_001568824 |
ABC transporter ATP-binding protein [Escherichia coli] Multiple sugar ABC transporter, ATP-bindingprotein [Escherichia coli] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_096321499 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_072971446 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_112891191 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_155104534 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] |
0.0 | 99 | 100.000 | WP_158118063 |
MULTISPECIES: ABC transporter ATP-binding protein [Proteobacteria] PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized ABC transporter ATP-binding protein YcjV [Escherichia coli K-12] ABC transporter related [Escherichia coli ATCC 8739] ABC transporter related [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] putative sugar transport protein [Escherichia coli B str. REL606] putative sugar transport protein [Escherichia coli BL21(DE3)] putative sugar transporter subunit: ATP-binding component of ABC superfamily protein [Escherichia coli 1303] putative uncharacterized ABC transporter ATP-binding protein YcjV [Escherichia coli VR50] putative sugar transport protein [Escherichia coli PCN061] sugar ABC transporter ATP-binding protein [Escherichia coli B] sugar ABC transporter ATP-binding protein [Escherichia coli str. Sanji] ABC transporter ATP-binding protein [Escherichia coli C] sugar ABC transporter, ATP-binding protein [Escherichia coli 53638] sugar ABC transporter, ATP-binding protein [Escherichia coli 101-1] ABC transporter, ATP-binding protein [Escherichia coli MS 196-1] ABC transporter, ATP-binding protein [Escherichia coli MS 175-1] ABC transporter, ATP-binding protein [Escherichia coli MS 116-1] ABC transporter, ATP-binding protein [Escherichia coli MS 187-1] uncharacterized ABC transporter ATP-binding protein ycjV [Escherichia coli 1827-70] ABC transporter [Escherichia coli E1520] ABC transporter [Escherichia coli E482] ABC transporter [Escherichia coli H489] ABC transporter [Escherichia coli TA007] hypothetical protein ECG581_1667 [Escherichia coli G58-1] ABC transporter family protein [Escherichia coli DEC7B] hypothetical protein ESSG_04580 [Escherichia coli H730] TOBE domain protein [Escherichia coli B41] putative sugar transport protein [Escherichia coli 75] putative ABC transporter ATP-binding protein ycjV [Escherichia coli AD30] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE10] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE44] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE212] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE51] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE56] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE154] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE120] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE232] ABC transporter family protein [Escherichia coli 2785200] ABC transporter family protein [Escherichia coli 174750] ABC transporter family protein [Escherichia coli P0305260.1] ABC transporter family protein [Escherichia coli P0299438.2] ABC transporter family protein [Escherichia coli 201600.1] ABC transporter family protein [Escherichia coli P0299438.10] ABC transporter family protein [Escherichia coli P0299438.4] ABC transporter family protein [Escherichia coli P0299438.9] ABC transporter family protein [Escherichia coli P0305260.2] ABC transporter family protein [Escherichia coli P0305260.10] ABC transporter family protein [Escherichia coli P0305260.11] ABC transporter family protein [Escherichia coli P0305260.12] ABC transporter family protein [Escherichia coli P0305260.13] ABC transporter family protein [Escherichia coli P0305260.3] ABC transporter family protein [Escherichia coli P0305260.4] ABC transporter family protein [Escherichia coli P0305260.5] ABC transporter family protein [Escherichia coli P0305260.6] ABC transporter family protein [Escherichia coli P0305260.8] ABC transporter ATP-binding protein [Escherichia coli KTE35] ABC transporter ATP-binding protein [Escherichia coli KTE14] ABC transporter ATP-binding protein [Escherichia coli KTE34] ABC transporter ATP-binding protein [Escherichia coli KTE198] ABC transporter ATP-binding protein [Escherichia coli KTE103] ABC transporter ATP-binding protein [Escherichia coli KTE107] ABC transporter ATP-binding protein [Escherichia coli KTE132] ABC transporter ATP-binding protein [Escherichia coli KTE130] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 91 (4-4638751)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 164 (4-5953081)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 221 (4-3136817)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KOEGE 40 (102a)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3139-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3174-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3212-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3240-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3314-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3329-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3318-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KOEGE 3 (4a)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KOEGE 7 (16a)] ABC transporter, ATP-binding protein [Escherichia coli 908658] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 50 (4-2593475)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 39] putative sugar transport protein [Escherichia coli ECC-Z] putative sugar transport protein [Escherichia coli ECA-727] ABC transporter family protein [Escherichia coli 1-176-05_S1_C1] ABC transporter family protein [Escherichia coli 1-250-04_S4_C2] ABC transporter family protein [Escherichia coli 1-250-04_S4_C1] ABC transporter family protein [Escherichia coli 1-392-07_S3_C3] ABC transporter family protein [Escherichia coli 1-176-05_S1_C3] ABC transporter family protein [Escherichia coli 1-176-05_S1_C2] ABC transporter family protein [Escherichia coli 2-011-08_S4_C1] ABC transporter family protein [Escherichia coli 2-052-05_S3_C1] ABC transporter family protein [Escherichia coli 2-011-08_S4_C3] ABC transporter family protein [Escherichia coli 3-105-05_S1_C1] ABC transporter family protein [Escherichia coli 3-105-05_S4_C3] ABC transporter family protein [Escherichia coli 3-373-03_S3_C1] ABC transporter family protein [Escherichia coli 3-475-03_S1_C1] ABC transporter family protein [Escherichia coli 3-373-03_S4_C2] ABC transporter family protein [Escherichia coli 3-073-06_S4_C1] ABC transporter family protein [Escherichia coli 3-373-03_S4_C1] ABC transporter family protein [Escherichia coli 3-475-03_S4_C2] ABC transporter family protein [Escherichia coli 4-203-08_S1_C1] ABC transporter family protein [Escherichia coli 2-052-05_S3_C3] ABC transporter family protein [Escherichia coli 2-156-04_S3_C3] ABC transporter family protein [Escherichia coli 2-156-04_S4_C1] ABC transporter family protein [Escherichia coli 1-392-07_S3_C2] ABC transporter family protein [Escherichia coli 1-392-07_S3_C1] ABC transporter family protein [Escherichia coli 2-156-04_S4_C3] ABC transporter family protein [Escherichia coli 2-177-06_S3_C2] ABC transporter family protein [Escherichia coli 2-210-07_S3_C1] ABC transporter family protein [Escherichia coli 2-210-07_S4_C2] ABC transporter family protein [Escherichia coli 2-210-07_S4_C3] ABC transporter family protein [Escherichia coli 2-222-05_S4_C2] ABC transporter family protein [Escherichia coli 2-316-03_S3_C1] ABC transporter family protein [Escherichia coli 2-316-03_S4_C2] ABC transporter family protein [Escherichia coli 2-427-07_S4_C1] ABC transporter family protein [Escherichia coli 2-474-04_S1_C2] ABC transporter family protein [Escherichia coli 3-073-06_S1_C2] ABC transporter family protein [Escherichia coli 3-073-06_S4_C3] ABC transporter family protein [Escherichia coli 3-105-05_S1_C3] ABC transporter family protein [Escherichia coli 4-203-08_S1_C2] ABC transporter family protein [Escherichia coli 4-203-08_S1_C3] ABC transporter family protein [Escherichia coli 4-203-08_S3_C3] ABC transporter family protein [Escherichia coli 4-203-08_S3_C2] ABC transporter family protein [Escherichia coli 3-373-03_S4_C3] ABC transporter family protein [Escherichia coli 5-172-05_S4_C2] ABC transporter family protein [Escherichia coli 5-172-05_S4_C1] ABC transporter family protein [Escherichia coli 5-172-05_S4_C3] ABC transporter family protein [Escherichia coli 5-172-05_S1_C3] ABC transporter family protein [Escherichia coli 6-175-07_S4_C2] ABC transporter family protein [Escherichia coli 6-175-07_S4_C1] ABC transporter family protein [Escherichia coli 6-319-05_S4_C2] ABC transporter family protein [Escherichia coli 6-175-07_S4_C3] ABC transporter family protein [Escherichia coli 6-319-05_S4_C3] ABC transporter family protein [Escherichia coli 2-222-05_S4_C1] ABC transporter family protein [Escherichia coli 6-537-08_S4_C1] ABC transporter family protein [Escherichia coli 7-233-03_S3_C2] ABC transporter family protein [Escherichia coli 7-233-03_S4_C1] ABC transporter family protein [Escherichia coli 7-233-03_S4_C3] ABC transporter family protein [Escherichia coli 6-537-08_S4_C2] ABC transporter family protein [Escherichia coli 2-052-05_S3_C2] ABC transporter family protein [Escherichia coli 2-177-06_S3_C3] ABC transporter family protein [Escherichia coli 2-222-05_S4_C3] ABC transporter family protein [Escherichia coli 5-366-08_S4_C1] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli OP50] putative ABC transporter ATP-binding protein [Escherichia coli PCN009] putative ATP-binding component of a transport system [Escherichia coli TA144] sugar ABC transporter, ATP-binding protein [Escherichia coli B921] putative ATP-binding component of a transport system [Escherichia coli E1002] putative ATP-binding component of a transport system [Escherichia coli H386] putative ATP-binding component of a transport system [Escherichia coli H617] putative ATP-binding component of a transport system [Escherichia coli H454] putative ATP-binding component of a transport system [Escherichia coli TA008] ABC transporter ATP-binding protein [Escherichia coli O80:H26] predicted sugar transporter subunit: ATP-binding component of ABC superfamily [Escherichia coli ETEC H10407] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli O10:K5(L):H4 str. ATCC 23506] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli O5:K4(L):H4 str. ATCC 23502] Multiple sugar ABC transporter, ATP-binding protein [Klebsiella pneumoniae IS22] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli IS25] sugar transporter subunit [Escherichia coli O8:H8] ABC transporter ATP-binding protein [Shigella sp.] |
0.0 | 99 | 100.000 | WP_000057985 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter family protein [Escherichia coli 1-110-08_S3_C3] ABC transporter family protein [Escherichia coli 1-110-08_S3_C2] ABC transporter family protein [Escherichia coli 1-110-08_S3_C1] |
0.0 | 99 | 100.000 | WP_032229760 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_116290060 |
ABC transporter ATP-binding protein [Escherichia coli] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_048266840 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_152930762 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_073511876 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_053270391 |
ABC transporter ATP-binding protein [Escherichia coli] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3151-1] |
0.0 | 99 | 100.000 | WP_021559094 |
ABC transporter ATP-binding protein [Escherichia coli] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3199-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3148-1] |
0.0 | 99 | 100.000 | WP_021563661 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_147699180 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_112915315 |
ABC transporter ATP-binding protein [Escherichia coli] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 99 | 100.000 | WP_115188302 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_149785934 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] |
0.0 | 99 | 100.000 | WP_063120982 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_096222380 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_076486581 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | MHR15339 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_047603311 |
ABC transporter ATP-binding protein [Escherichia coli KTE73] |
0.0 | 99 | 100.000 | EOV79878 |
MULTISPECIES: ABC transporter ATP-binding protein [Enterobacteriaceae] sugar ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Shigella sonnei] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_058905599 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_089625226 |
ABC transporter ATP-binding protein [Escherichia coli] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 99 | 100.000 | WP_115185540 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_096218835 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter family protein [Escherichia coli 1-176-05_S3_C1] ABC transporter family protein [Escherichia coli 5-172-05_S3_C3] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_032234617 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter family protein [Escherichia coli 3-105-05_S1_C2] |
0.0 | 99 | 100.000 | WP_032250273 |
ABC transporter ATP-binding protein [Escherichia coli] putative sugar transporter subunit: ATP-binding component of ABC superfamily protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_061358058 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_112902035 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_094396248 |
ABC transporter ATP-binding protein, partial [Escherichia coli] sugar ABC transporter ATP-binding protein, partial [Escherichia coli] |
0.0 | 99 | 100.000 | WP_065769055 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_112929201 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_103774644 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | MQJ19998 |
ABC transporter ATP-binding protein [Escherichia coli] putative sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli NC101] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE16] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE15] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE224] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE72] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE86] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE93] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE169] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE43] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE194] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE183] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE207] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE215] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE113] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE133] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE145] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE168] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE88] ABC transporter ATP-binding protein [Escherichia coli KTE89] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 38 (4-2774682)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3391-1] ABC transporter family protein [Escherichia coli 3-073-06_S1_C1] TOBE domain protein [Escherichia coli 9.1649] putative ATP-binding component of a transport system [Escherichia coli H588] putative ATP-binding component of a transport system [Escherichia coli H223] ABC transporter ATP-binding protein [Escherichia coli O2:H6] |
0.0 | 99 | 99.605 | WP_000057971 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_098717316 |
hypothetical protein C22711_4994 [Escherichia coli O104:H4 str. C227-11] ABC transporter [Escherichia coli O26:H11 str. CVM9942] sugar transporter subunit [Escherichia coli] sugar transporter subunit [Escherichia coli] sugar transporter subunit [Escherichia coli] |
0.0 | 100 | 99.216 | EGT70960 |
ABC transporter ATP-binding protein [Escherichia coli] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE216] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE162] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE173] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE175] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE211] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE139] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE148] ABC transporter, ATP-binding protein [Escherichia coli 907446] ABC transporter ATP-binding protein [Escherichia coli O25b:H4] putative ABC transporter ATP-binding component [Escherichia coli SE15] |
0.0 | 99 | 99.605 | WP_000068007 |
ABC transporter ATP-binding protein [Escherichia coli] sugar transporter subunit [Escherichia coli] |
0.0 | 99 | 100.000 | WP_137573194 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_106708537 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_063097298 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 100.000 | WP_151292918 |
ABC transporter ATP-binding protein [Escherichia coli] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 99 | 99.605 | WP_113419092 |
ATP-binding cassette domain-containing protein [Escherichia coli] ATP-binding cassette domain-containing protein [Escherichia coli] ATP-binding cassette domain-containing protein [Escherichia coli] ATP-binding cassette domain-containing protein [Escherichia coli] |
0.0 | 99 | 100.000 | MWM20841 |
MULTISPECIES: ABC transporter ATP-binding protein [Escherichia] sugar ABC transporter ATP-binding protein [Escherichia fergusonii] sugar ABC transporter ATP-binding protein [Escherichia fergusonii] |
0.0 | 99 | 99.605 | WP_104917314 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | KAB3047413 |
ABC transporter ATP-binding protein [Escherichia coli] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli O145:H28 str. RM13514] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli O145:H28 str. RM13516] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli O145:H28 str. RM12761] Multiple sugar ABC transporter, ATP-binding protein [Escherichia coli O145:H28 str. RM12581] ABC transporter ATP-binding protein [Escherichia coli O145 str. RM9872] ABC transporter ATP-binding protein [Escherichia coli O145] sugar ABC transporter ATP-binding protein [Escherichia coli ATCC 35150] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3521] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3526] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3518] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3516] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3517] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3510] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3511] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3509] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3507] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 08-4270] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-4557C2] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 06-3484] sugar ABC transporter ATP-binding protein [Escherichia coli O145:NM str. 2010C-3508] ABC transporter ATP-binding protein [Escherichia coli O145:NM] sugar transporter subunit [Escherichia coli O145:H28] |
0.0 | 99 | 99.605 | WP_022581764 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_096179963 |
ABC transporter ATP-binding protein [Escherichia coli] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3592-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3609-1] ABC transporter family protein [Escherichia coli 2-222-05_S3_C3] ABC transporter family protein [Escherichia coli 2-222-05_S3_C1] ABC transporter family protein [Escherichia coli 2-222-05_S3_C2] |
0.0 | 99 | 99.605 | WP_021572798 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli O86:H34 str. 99-3124] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 99 | 99.605 | WP_032328805 |
ABC transporter ATP-binding protein [Escherichia coli] hypothetical protein EC07798_1998 [Escherichia coli 07798] |
0.0 | 99 | 99.605 | WP_000057950 |
ABC transporter ATP-binding protein [Escherichia coli] hypothetical protein ESRG_03445 [Escherichia coli TA124] |
0.0 | 99 | 99.605 | WP_000057974 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_128111487 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_096293232 |
MULTISPECIES: ABC transporter ATP-binding protein [Enterobacteriaceae] sugar ABC transporter, ATP-binding protein [Escherichia coli SMS-3-5] ABC transporter, ATP-binding protein [Escherichia coli MS 69-1] ABC transporter, ATP-binding protein [Escherichia coli MS 115-1] ABC transporter family protein [Shigella flexneri SFJ17B] hypothetical protein ECSTECMHI813_1455 [Escherichia coli STEC_MHI813] putative sugar transport protein [Escherichia coli KD2] hypothetical protein EC3006_1668 [Escherichia coli 3006] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE21] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE234] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE50] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE146] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE202] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KTE125] ABC transporter family protein [Escherichia coli P0301867.1] ABC transporter family protein [Escherichia coli 2719100] ABC transporter family protein [Escherichia coli P0301867.4] ABC transporter family protein [Escherichia coli P0301867.2] ABC transporter family protein [Escherichia coli 178900] ABC transporter family protein [Escherichia coli P0301867.11] ABC transporter family protein [Escherichia coli P0301867.8] ABC transporter family protein [Escherichia coli P0301867.13] ABC transporter family protein [Escherichia coli P0301867.3] ABC transporter family protein [Escherichia coli P0301867.5] ABC transporter family protein [Escherichia coli P0301867.7] ABC transporter ATP-binding protein [Escherichia coli KTE20] ABC transporter ATP-binding protein [Escherichia coli KTE64] ABC transporter ATP-binding protein [Escherichia coli KTE100] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 25 (4-5851939)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 43 (4-2173468)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 44 (4-2298570)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 65 (4-2262045)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 182 (4-0985554)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli KOEGE 77 (202a)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3718-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3144-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 19C] ABC transporter, ATP-binding protein [Escherichia coli 110957] ABC transporter, ATP-binding protein [Escherichia coli 907672] ABC transporter, ATP-binding protein [Escherichia coli 908525] ABC transporter, ATP-binding protein [Escherichia coli 908573] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli UMEA 3323-1] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BWH 32] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 136 (4-5970458)] sugar ABC transporter ATP-binding protein [Escherichia coli LAU-EC8] sugar ABC transporter ATP-binding protein [Escherichia coli LAU-EC9] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 43b] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 43a] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 19B] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 19A] hypothetical protein L447_07832 [Escherichia coli BIDMC 17B] hypothetical protein L446_05775 [Escherichia coli BIDMC 17A] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 15] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 9] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 3] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 2B] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BWH 40] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 6] sugar ABC transporter ATP-binding protein [Escherichia coli O15:H18 str. K1516] ABC transporter family protein [Escherichia coli 1-250-04_S1_C3] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 82] hypothetical protein AE46_01263 [Escherichia coli BIDMC 71] hypothetical protein AE52_04138 [Escherichia coli BIDMC 77] ABC transporter family protein [Escherichia coli 1-250-04_S1_C2] ABC transporter family protein [Escherichia coli 1-250-04_S1_C1] ABC transporter family protein [Escherichia coli 6-537-08_S1_C1] ABC transporter family protein [Escherichia coli 6-537-08_S1_C2] ABC transporter family protein [Escherichia coli 6-537-08_S1_C3] putative ABC transporter ATP-binding protein [Escherichia coli PCN079] putative ATP-binding component of a transport system [Escherichia coli TA054] ABC transporter ATP-binding protein [Escherichia coli O157] ABC transporter ATP-binding protein [Escherichia coli O1:H42] ABC transporter ATP-binding protein [Escherichia coli K-12] ABC transporter ATP-binding protein [Shigella sp.] |
0.0 | 99 | 99.605 | WP_000057972 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_025270032 |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_152920330 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_136149418 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter family protein [Escherichia coli 2-156-04_S1_C3] ABC transporter ATP-binding protein [Escherichia coli] sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] sugar transporter subunit: ATP-binding component of ABC superfamily transporter [Escherichia coli] |
0.0 | 99 | 99.605 | WP_032177218 |
MULTISPECIES: ABC transporter ATP-binding protein [unclassified Escherichia] ABC transporter ATP-binding protein [Escherichia sp. E1V33] ABC transporter ATP-binding protein [Escherichia sp. E1S7] |
0.0 | 99 | 99.605 | WP_130236439 |
ATP-binding cassette domain-containing protein, partial [Escherichia coli] |
0.0 | 99 | 99.605 | WP_146759444 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_097735325 |
ABC transporter ATP-binding protein [Escherichia coli] putative sugar ABC transporter ATP-binding protein transporter [Escherichia coli IAI39] putative sugar ABC transporter ATP-binding protein transporter [Escherichia coli O7:K1 str. CE10] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 53 (4-0631051)] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli HVH 187 (4-4471660)] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_000057973 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_033808658 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_113450170 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_136145649 |
ABC transporter ATP-binding protein [Escherichia coli] maltose/maltodextrin transport system ATP-binding protein [Escherichia coli BIDMC 37] sugar ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_023281735 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.209 | WP_096856184 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_089551504 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_086589444 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_044708243 |
ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] sugar ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_072663290 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_136153471 |
ABC transporter ATP-binding protein [Escherichia coli] ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_089075694 |
ABC transporter ATP-binding protein [Escherichia coli] |
0.0 | 99 | 99.605 | WP_115901901 |
ABC transporter ATP-binding protein [Escherichia coli] sugar transporter subunit [Escherichia coli] |
0.0 | 99 | 99.605 | WP_137433886 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_3 In ecoli U00096.3
Seq (len = 306 ):
MRYILDLGPTVMLPIVIIIFSKILGMKAGDCFKAGLHIGIGFVGIGLVIGLMLDSIGPAAKAMAENFDLNLHVVDVGWPGSSPMTWASQIALVAIPIAILVNVAMLLTRMTRVVNVDIWNIWHMTFTGALLHLATGSWMIGMAGVVIHAAFVYKLGDWFARDTRNFFELEGIAIPHGTSAYMGPIAVLVDAIIEKIPGVNRIKFSADDIQRKFGPFGEPVTVGFVMGLIIGILAGYDVKGVLQLAVKTAAVMLLMPRVIKPIMDGLTPIAKQARSRLQAKFGGQEFLIGLDPALLLGHTAGWYRQA
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|259097|-1|2173345-2174281
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
4.753829808242078
unique PSMS
6
unique PSMS
6
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
galactitol-specific phosphotransferase system IIC component [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
galactitol-specific phosphotransferase system IIC component [Escherichia coli] galactitol-specific phosphotransferase system IIC component [Escherichia coli] |
0.0 | 100 | 100.000 | RED94056 |
galactitol-specific PTS system EIIC component [Escherichia coli] galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 100.000 | CTR39548 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli P0302308.10] |
0.0 | 98 | 100.000 | WP_001493189 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_123902885 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_135493336 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_039022236 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli O157:H7 str. 2010C-4979C1] |
0.0 | 98 | 100.000 | WP_032306646 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_096854554 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_152930293 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli BIDMC 39] |
0.0 | 98 | 100.000 | WP_023281353 |
galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 99.667 | SQM36195 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_088209879 |
galactitol-specific PTS system EIIC component [Escherichia coli] galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 99.667 | STH44789 |
PTS galactitol transporter subunit IIC, partial [Shigella sonnei] |
0.0 | 98 | 100.000 | WP_052962266 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_109549797 |
MULTISPECIES: PTS galactitol transporter subunit IIC [Enterobacteriaceae] PTS system galactitol-specific enzyme IIC [Shigella sonnei Ss046] PTS system protein, galactitol-specific IIC component family protein [Shigella sonnei 53G] galactitol permease IIC component [Shigella sonnei 3226-85] galactitol permease IIC component [Shigella sonnei 3233-85] PTS system, galactitol-specific IIC component family protein [Shigella sonnei str. Moseley] |
0.0 | 98 | 100.000 | WP_000490683 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_042004170 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | MHW80993 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol permease IIC component [Escherichia coli 3-105-05_S4_C3] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_032255016 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli 180050] |
0.0 | 98 | 100.000 | WP_001742006 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_065221612 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS system EIIC permease component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_097758059 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_097415193 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_072657456 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_073464485 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_038976927 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol permease IIC component [Escherichia coli 2-427-07_S4_C1] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_024239142 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | MXG84210 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_064236638 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_113388469 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_096840088 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_074523278 |
MULTISPECIES: galactitol permease IIC component [Enterobacteriaceae] galactitol permease IIC component [Escherichia coli BIDMC 19C] PTS galactitol transporter subunit IIC [Escherichia coli LAU-EC8] PTS galactitol transporter subunit IIC [Escherichia coli LAU-EC9] galactitol permease IIC component [Escherichia coli BIDMC 43b] galactitol permease IIC component [Escherichia coli BIDMC 43a] galactitol permease IIC component [Escherichia coli BIDMC 19B] galactitol permease IIC component [Escherichia coli BIDMC 19A] galactitol permease IIC component [Escherichia coli BIDMC 17B] galactitol permease IIC component [Escherichia coli BIDMC 17A] galactitol permease IIC component [Escherichia coli BIDMC 9] galactitol permease IIC component [Escherichia coli BIDMC 15] galactitol permease IIC component [Escherichia coli BIDMC 3] galactitol permease IIC component [Escherichia coli BIDMC 2B] galactitol permease IIC component [Escherichia coli BIDMC 6] galactitol permease IIC component [Escherichia coli BIDMC 82] galactitol permease IIC component [Escherichia coli BIDMC 71] Galactitol permease IIC component [Escherichia coli PCN079] PTS galactitol transporter subunit IIC [Escherichia coli O1:H42] PTS system, galactitol-specific IIC component [Escherichia coli IS5] |
0.0 | 98 | 100.000 | WP_022645856 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_158158738 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli UMEA 3592-1] galactitol permease IIC component [Escherichia coli UMEA 3609-1] galactitol permease IIC component [Escherichia coli 2-222-05_S3_C3] galactitol permease IIC component [Escherichia coli 2-222-05_S3_C1] galactitol permease IIC component [Escherichia coli 2-222-05_S3_C2] galactitol permease IIC component (PTS system galactitol-specific EIICcomponent) (EIIC-Gat) [Escherichia coli R424] |
0.0 | 98 | 100.000 | WP_021572873 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_097507325 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_136736493 |
PTS system, galactitol-specific IIC component family protein [Shigella sonnei 4822-66] |
0.0 | 98 | 100.000 | EIQ52442 |
PTS galactitol transporter subunit IIC [Escherichia coli] Galactitol permease IIC component [Escherichia coli LF82] |
0.0 | 98 | 100.000 | WP_000478251 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_101973484 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS system, galactitol-specific IIC component [Escherichia coli KD1] galactitol permease IIC component [Escherichia coli KTE94] galactitol permease IIC component [Escherichia coli SWW33] galactitol permease IIC component [Escherichia coli KTE185] PTS galactitol transporter subunit IIC [Escherichia coli MP1] galactitol permease IIC component [Escherichia coli K02] galactitol permease IIC component (PTS system galactitol-specific EIICcomponent) (EIIC-Gat) [Escherichia coli H001] |
0.0 | 98 | 100.000 | WP_000490677 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_088129920 |
PTS system EIIC permease component [Escherichia coli] |
0.0 | 98 | 100.000 | GCH85492 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_096111205 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | MWK94677 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli 907357] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_023156259 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol permease IIC component [Escherichia coli MS 198-1] galactitol permease IIC component [Escherichia coli HVH 223 (4-2976528)] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_000490676 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_097340030 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_096975021 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_113383152 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_052901197 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_112023138 |
MULTISPECIES: PTS galactitol transporter subunit IIC [Enterobacteriaceae] PTS system, galactitol-specific IIC component [Escherichia coli SMS-3-5] galactitol permease IIC component [Escherichia coli MS 21-1] galactitol permease IIC component [Escherichia coli B093] galactitol permease IIC component [Escherichia coli 5.0588] galactitol permease IIC component [Escherichia coli 3.2303] PTS system, galactitol-specific IIC component [Escherichia coli TW15901] PTS system, galactitol-specific IIC component [Escherichia coli TW00353] galactitol permease IIC component [Escherichia coli KTE75] galactitol permease IIC component [Escherichia coli KTE143] galactitol permease IIC component [Escherichia coli KTE24] galactitol permease IIC component [Escherichia coli KTE36] galactitol permease IIC component [Escherichia coli KTE37] galactitol permease IIC component [Escherichia coli KTE38] galactitol permease IIC component [Escherichia coli KTE69] galactitol permease IIC component [Escherichia coli KTE70] galactitol permease IIC component [Escherichia coli KTE74] galactitol permease IIC component [Escherichia coli KTE98] galactitol permease IIC component [Escherichia coli HVH 46 (4-2758776)] galactitol permease IIC component [Escherichia coli HVH 87 (4-5977630)] galactitol permease IIC component [Escherichia coli HVH 153 (3-9344314)] galactitol permease IIC component [Escherichia coli UMEA 3160-1] galactitol permease IIC component [Escherichia coli UMEA 3190-1] galactitol permease IIC component [Escherichia coli UMEA 3304-1] galactitol permease IIC component [Escherichia coli 907672] galactitol permease IIC component [Escherichia coli 908525] PTS galactitol transporter subunit IIC [Escherichia coli O157:H16 str. 98-3133] galactitol permease IIC component (PTS system galactitol-specific EIICcomponent) (EIIC-Gat) [Escherichia coli H617] |
0.0 | 98 | 100.000 | WP_000490678 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS system galactitol-specific transporter subunit IIC [Escherichia coli O83:H1 str. NRG 857C] galactitol permease IIC component [Escherichia coli TW07793] galactitol permease IIC component [Escherichia coli KTE186] galactitol permease IIC component [Escherichia coli HVH 9 (4-6942539)] galactitol permease IIC component [Escherichia coli HVH 70 (4-2963531)] galactitol permease IIC component [Escherichia coli HVH 158 (4-3224287)] galactitol permease IIC component [Escherichia coli HVH 175 (4-3405184)] galactitol permease IIC component [Escherichia coli HVH 184 (4-3343286)] galactitol permease IIC component [Escherichia coli HVH 194 (4-2356805)] galactitol permease IIC component [Escherichia coli KOEGE 10 (25a)] PTS galactitol transporter subunit IIC [Escherichia coli O81:NM str. 02-3012] galactitol permease IIC component [Escherichia coli 2-005-03_S4_C3] galactitol permease IIC component [Escherichia coli 2-005-03_S4_C2] galactitol permease IIC component [Escherichia coli 2-052-05_S4_C1] PTS galactitol transporter subunit IIC [Escherichia coli MRSN 10204] PTS galactitol transporter subunit IIC [Escherichia coli APEC O2] |
0.0 | 98 | 100.000 | WP_000490682 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] galactitol-specific PTS system EIIC component [Escherichia coli 042] galactitol-specific PTS system EIIC component [Escherichia coli] galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_000490674 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_097750476 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_078205935 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli 1-110-08_S3_C3] galactitol permease IIC component [Escherichia coli 1-110-08_S3_C2] galactitol permease IIC component [Escherichia coli 1-110-08_S3_C1] galactitol permease IIC component [Escherichia coli 5-366-08_S4_C1] galactitol permease IIC component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_032229984 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_152922638 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_130061288 |
galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 100.000 | STI74645 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol permease IIC component [Escherichia coli MS 115-1] |
0.0 | 98 | 100.000 | WP_000490684 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli O111:H-] |
0.0 | 98 | 100.000 | WP_112995968 |
PTS galactitol transporter subunit IIC [Shigella dysenteriae] PTS galactitol transporter subunit IIC [Shigella dysenteriae] |
0.0 | 98 | 100.000 | WP_105315862 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS system EIIC permease component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_096984101 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli O177:NM str. 2010C-4558] PTS galactitol transporter subunit IIC [Escherichia coli O145:H28 str. 2009C-3292] PTS galactitol transporter subunit IIC [Escherichia coli O145:H25 str. 07-3858] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_024226538 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_097503605 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli HVH 195 (3-7155360)] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_021542173 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_059329031 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_073860852 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS system EIIC permease component [Escherichia coli] PTS system EIIC permease component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_137541943 |
MULTISPECIES: PTS galactitol transporter subunit IIC [Enterobacteriaceae] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Shigella sonnei] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_094337543 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_113264334 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_086676344 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_109551174 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_151411891 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS system EIIC permease component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_137566800 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 99.667 | WP_113519534 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli KTE146] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_001602895 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | KAB3048674 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_149556640 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol permease IIC component [Escherichia coli 1-250-04_S3_C1] galactitol permease IIC component [Escherichia coli 1-250-04_S3_C2] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_032281189 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_089534907 |
MULTISPECIES: PTS galactitol transporter subunit IIC [Enterobacteriaceae] PTS system, galactitol-specific IIC component family protein [Escherichia coli UMNF18] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19] PTS galactitol transporter subunit IIC [Escherichia coli O121 str. RM8352] PTS system, galactitol-specific IIC component family protein [Escherichia coli STEC_EH250] PTS system, galactitol-specific IIC component family protein [Escherichia coli STEC_S1191] galactitol permease IIC component [Escherichia coli 5.0959] galactitol permease IIC component [Escherichia coli 2.3916] PTS system, galactitol-specific IIC component [Escherichia coli 0.1288] galactitol permease IIC component [Escherichia coli KTE156] galactitol-specific enzyme IIC component of PTS [Escherichia coli ONT:H33 str. C48/93] galactitol permease IIC component [Escherichia coli 2722950] galactitol permease IIC component [Escherichia coli BCE011_MS-01] galactitol permease IIC component [Escherichia coli MP021561.3] galactitol permease IIC component [Escherichia coli KTE71] galactitol permease IIC component [Escherichia coli KTE155] galactitol permease IIC component [Escherichia coli UMEA 3889-1] galactitol permease IIC component [Escherichia coli UMEA 3150-1] PTS galactitol transporter subunit IIC [Escherichia coli ATCC BAA-2219] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-4254] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-3840] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-3609] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2009EL1412] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2009C-4659] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2011C-3537] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2011C-3500] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2011C-3216] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2011C-3108] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2011C-3072] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010EL1058] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-4989] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-4966] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-4824] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-4732] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 06-3822] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 06-3003] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 03-3227] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. F6714] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. K5198] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. K5269] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2009C-4050] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2009C-4750] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2009EL1302] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2010C-3794] galactitol permease IIC component [Escherichia coli 3-373-03_S3_C3] galactitol permease IIC component [Escherichia coli 3-373-03_S3_C2] PTS galactitol transporter subunit IIC [Escherichia coli O121:H19 str. 2011C-3609] galactitol permease IIC component [Escherichia coli 2-156-04_S4_C2] galactitol permease IIC component [Escherichia coli 3-020-07_S4_C2] galactitol permease IIC component [Escherichia coli 3-020-07_S4_C3] PTS system galactitol-specific transporter subunit IIC [Escherichia coli VL2874] galactitol permease IIC component (PTS system galactitol-specific EIICcomponent) (EIIC-Gat) [Escherichia coli E560] PTS system, sorbitol-specific IIC component [Escherichia coli B175] PTS galactitol transporter subunit IIC [Escherichia coli O177] PTS system EIIC permease component [Escherichia coli O8:H8] |
0.0 | 98 | 100.000 | WP_000490675 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol-specific PTS system EIIC component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_112043810 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_127762795 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_146883692 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_113418809 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli 2875150] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_001405402 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_097475113 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS system EIIC permease component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_137502114 |
galactitol permease IIC component [Escherichia coli] galactitol permease IIC component [Escherichia coli P0305260.12] |
0.0 | 98 | 100.000 | WP_001639679 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_112919235 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_152933189 |
PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | TZE00106 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol permease IIC component [Escherichia coli 3-105-05_S1_C1] galactitol permease IIC component [Escherichia coli 3-475-03_S4_C2] galactitol permease IIC component [Escherichia coli 3-105-05_S1_C3] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_032237265 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_064221481 |
PTS galactitol transporter subunit IIC [Escherichia coli] PTS system EIIC permease component [Escherichia coli] |
0.0 | 98 | 100.000 | WP_137537983 |
PTS galactitol transporter subunit IIC, partial [Shigella sonnei] |
0.0 | 98 | 100.000 | WP_065405196 |
PTS galactitol transporter subunit IIC [Escherichia coli] galactitol-specific enzyme IIC component of PTS [Escherichia coli IAI39] galactitol-specific enzyme IIC component of PTS [Escherichia coli O7:K1 str. CE10] galactitol permease IIC component [Escherichia coli HVH 53 (4-0631051)] galactitol permease IIC component [Escherichia coli HVH 187 (4-4471660)] galactitol permease IIC component [Escherichia coli UMEA 3899-1] PTS galactitol transporter subunit IIC [Escherichia coli] |
0.0 | 98 | 100.000 | WP_000490680 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_4 In ecoli U00096.3
Seq (len = 154 ):
MLVPALLVAGAANAAEVYNKDGNKLDLYGKVVGLHYFSDDSGSDGDMSYARIGFKGETQIADQFTGYGQWEFNIGANGPESDKGNTATRLAFAGLGFGQNGTFDYGRNYGVVYDVEAWTDMLPEFGGDTYAGADNFMNGRANGVATYRNNGFFG
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|75632|1|2033954-2034533
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
9.324832910336605
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
outer membrane porin truncated homolog b1964 precursor [similarity] - Escherichia coli (strain K-12) [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
outer membrane porin truncated homolog b1964 precursor [similarity] - Escherichia coli (strain K-12) [Escherichia coli] |
1.94e-106 | 100 | 100.000 | H64960 |
porin [Escherichia coli] PUTATIVE PSEUDOGENE: RecName: Full=Putative outer membrane protein YedS; Flags: Precursor [Escherichia coli K-12] putative outer membrane protein YedS [Escherichia coli J53] outer membrane protein yedS [Escherichia coli S17] outer membrane protein yedS [Escherichia coli NCTC 50110] putative outer membrane protein YedS [Escherichia coli KRX] outer membrane protein yedS [Escherichia coli DH1] |
2.68e-106 | 100 | 100.000 | WP_001407556 |
outer membrane protein N [Escherichia coli 3-373-03_S4_C2] outer membrane protein N [Escherichia coli 3-373-03_S4_C1] outer membrane protein N [Escherichia coli 3-373-03_S4_C3] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] |
8.55e-106 | 100 | 100.000 | KDU30209 |
Porin OmpN [Escherichia coli] |
1.34e-105 | 100 | 100.000 | SVF47292 |
outer membrane pore protein [Escherichia coli] Porin OmpN [Escherichia coli] |
2.8e-105 | 100 | 100.000 | GDP90689 |
porin, partial [Escherichia coli] Porin OmpN, partial [Escherichia coli 576-1] |
6.83e-105 | 100 | 98.052 | WP_000824407 |
outer membrane porin OmpK36 [Escherichia coli UMEA 3318-1] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] |
6.7e-104 | 100 | 98.052 | EQY92987 |
outer membrane pore protein [Escherichia coli] |
1e-103 | 100 | 100.000 | GDL62980 |
putative outer membrane protein YedS [Escherichia coli H591] |
1.07e-103 | 100 | 100.000 | EGI45626 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli 1-110-08_S1_C2] |
1.11e-103 | 100 | 100.000 | WP_032219878 |
porin OmpC, partial [Escherichia coli] |
1.14e-103 | 100 | 100.000 | WP_141219335 |
porin [Escherichia coli] gram-negative porin [Escherichia coli 3.3884] outer membrane protein N [Escherichia coli 3-267-03_S3_C2] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.21e-103 | 100 | 100.000 | WP_000824417 |
porin [Escherichia coli] |
1.26e-103 | 100 | 100.000 | WP_097425122 |
MULTISPECIES: porin [Escherichia] outer membrane protein S1 [Escherichia coli B799] outer membrane protein N [Escherichia coli 179100] outer membrane protein N [Escherichia coli 3-475-03_S3_C1] outer membrane protein N [Escherichia coli B574] porin OmpC [Shigella boydii] |
1.36e-103 | 100 | 100.000 | WP_000824418 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] |
1.43e-103 | 100 | 100.000 | WP_069904606 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] |
1.57e-103 | 100 | 100.000 | WP_047656155 |
outer membrane pore protein [Escherichia coli] |
1.71e-103 | 100 | 97.403 | GCN58092 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] Porin OmpN [Escherichia coli] outer membrane pore protein [Escherichia coli] |
2.62e-103 | 100 | 100.000 | WP_063077715 |
Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] |
3.37e-103 | 100 | 98.052 | SQM78838 |
MULTISPECIES: porin [unclassified Escherichia] porin [Escherichia sp. E4694] porin [Escherichia sp. E2748] |
6.15e-103 | 100 | 99.351 | WP_135491549 |
porin [Escherichia coli] |
6.3e-103 | 100 | 98.052 | WP_139497420 |
porin [Escherichia coli] |
1.12e-102 | 100 | 96.104 | WP_149005681 |
putative outer membrane protein [Escherichia coli O157:H7 str. EDL933] putative outer membrane protein [Escherichia coli] putative outer membrane protein [Escherichia coli] putative outer membrane protein [Escherichia coli] putative outer membrane protein [Escherichia coli Xuzhou21] |
1.27e-102 | 100 | 96.104 | AAG56978 |
porin [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] |
1.4e-102 | 100 | 98.701 | WP_029399947 |
gram-negative porin family protein [Escherichia coli 09BKT078844] |
1.5e-102 | 100 | 96.104 | ELV21566 |
porin [Escherichia coli] outer membrane porin OmpK36 [Escherichia coli UMEA 3292-1] outer membrane protein N [Escherichia coli 3-475-03_S3_C2] Porin OmpN [Escherichia coli] |
1.55e-102 | 100 | 99.351 | WP_021569420 |
porin [Escherichia coli] porin [Escherichia coli] |
1.7e-102 | 100 | 99.351 | WP_136724174 |
porin [Escherichia coli] |
1.7e-102 | 100 | 98.052 | EAA4909427 |
porin, partial [Escherichia coli] |
1.7e-102 | 100 | 97.403 | WP_089518357 |
outer membrane protein [Escherichia coli] putative outer membrane protein [Escherichia coli O157:H7 str. TW14359] Outer membrane protein N precursor [Escherichia coli O157:H7 str. SS17] Outer membrane protein N precursor [Escherichia coli O157:H7 str. EDL933] Outer membrane protein N precursor [Escherichia coli O157:H7 str. SS52] outer membrane protein [Escherichia coli O157:H7] outer membrane protein N (Porin OmpN) [Escherichia coli O157:H7 str. TW14588] outer membrane protein C [Escherichia coli DEC3A] outer membrane protein C [Escherichia coli DEC3C] outer membrane protein C [Escherichia coli DEC3D] outer membrane protein C [Escherichia coli DEC3E] outer membrane protein C [Escherichia coli DEC4A] outer membrane protein C [Escherichia coli DEC4B] outer membrane protein C [Escherichia coli DEC4C] outer membrane protein C [Escherichia coli DEC4D] outer membrane protein C [Escherichia coli DEC4E] outer membrane protein C [Escherichia coli DEC4F] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK1996] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FDA517] H-NS DNA-binding transcriptional dual regulator [Escherichia coli 93-001] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK1985] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK1990] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA3] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA9] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA10] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA15] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA14] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA22] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA25] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA24] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA28] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA32] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA31] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA33] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA41] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA42] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA39] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW10246] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW07945] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW11039] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW09109] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW09098] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW10119] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4203] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW09195] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4196] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TW14301] H-NS DNA-binding transcriptional dual regulator [Escherichia coli O157:H7 str. TW14313] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4421] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4422] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4013] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4402] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4439] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4436] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4437] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC4448] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1738] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1734] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1863] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1845] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA7] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK920] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA34] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FDA506] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FDA507] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FDA504] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK1999] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK1997] H-NS DNA-binding transcriptional dual regulator [Escherichia coli NE1487] H-NS DNA-binding transcriptional dual regulator [Escherichia coli NE037] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK2001] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA4] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA23] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA49] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA45] H-NS DNA-binding transcriptional dual regulator [Escherichia coli TT12B] H-NS DNA-binding transcriptional dual regulator [Escherichia coli MA6] H-NS DNA-binding transcriptional dual regulator [Escherichia coli CB7326] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA38] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1735] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1736] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1737] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1846] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1847] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1848] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1849] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1850] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1856] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1862] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1864] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1868] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1866] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1869] H-NS DNA-binding transcriptional dual regulator [Escherichia coli NE098] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC1870] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FRIK523] H-NS DNA-binding transcriptional dual regulator [Escherichia coli 0.1304] gram-negative porin family protein [Escherichia coli 5.2239] gram-negative porin family protein [Escherichia coli 3.4870] H-NS DNA-binding transcriptional dual regulator [Escherichia coli 6.0172] gram-negative porin family protein [Escherichia coli 8.0586] H-NS DNA-binding transcriptional dual regulator [Escherichia coli 10.0833] gram-negative porin family protein [Escherichia coli 8.2524] gram-negative porin family protein [Escherichia coli 88.0221] H-NS DNA-binding transcriptional dual regulator [Escherichia coli 8.0416] gram-negative porin family protein [Escherichia coli 10.0821] gram-negative porin family protein [Escherichia coli 88.1042] gram-negative porin family protein [Escherichia coli 89.0511] gram-negative porin family protein [Escherichia coli 88.1467] gram-negative porin family protein [Escherichia coli 90.2281] gram-negative porin family protein [Escherichia coli 90.0091] gram-negative porin family protein [Escherichia coli 90.0039] gram-negative porin family protein [Escherichia coli 93.0056] gram-negative porin family protein [Escherichia coli 93.0055] gram-negative porin family protein [Escherichia coli 94.0618] gram-negative porin family protein [Escherichia coli 95.0943] gram-negative porin family protein [Escherichia coli 95.0183] gram-negative porin family protein [Escherichia coli 95.1288] gram-negative porin family protein [Escherichia coli 96.0428] gram-negative porin family protein [Escherichia coli 96.0427] gram-negative porin family protein [Escherichia coli 96.0939] gram-negative porin family protein [Escherichia coli 96.0932] gram-negative porin family protein [Escherichia coli 96.0107] gram-negative porin family protein [Escherichia coli 97.0003] gram-negative porin family protein [Escherichia coli 97.0007] gram-negative porin family protein [Escherichia coli 99.0672] gram-negative porin family protein [Escherichia coli 97.1742] H-NS DNA-binding transcriptional dual regulator [Escherichia coli 99.0678] gram-negative porin family protein [Escherichia coli 99.0713] gram-negative porin family protein [Escherichia coli 96.0109] gram-negative porin family protein [Escherichia coli 97.0010] gram-negative porin family protein [Escherichia coli 99.0814] gram-negative porin family protein [Escherichia coli 99.0815] gram-negative porin family protein [Escherichia coli 99.0839] gram-negative porin family protein [Escherichia coli 99.0816] gram-negative porin family protein [Escherichia coli 99.0848] gram-negative porin family protein [Escherichia coli 99.1753] gram-negative porin family protein [Escherichia coli 99.1775] gram-negative porin family protein [Escherichia coli 99.1793] gram-negative porin family protein [Escherichia coli PA11] gram-negative porin family protein [Escherichia coli ATCC 700728] gram-negative porin family protein [Escherichia coli 99.1805] gram-negative porin family protein [Escherichia coli PA13] gram-negative porin family protein [Escherichia coli PA19] gram-negative porin family protein [Escherichia coli PA2] gram-negative porin family protein [Escherichia coli PA47] gram-negative porin family protein [Escherichia coli PA8] gram-negative porin family protein [Escherichia coli 7.1982] gram-negative porin family protein [Escherichia coli 99.1781] gram-negative porin family protein [Escherichia coli 99.1762] gram-negative porin family protein [Escherichia coli PA35] gram-negative porin family protein [Escherichia coli 3.4880] gram-negative porin family protein [Escherichia coli 95.0083] gram-negative porin family protein [Escherichia coli 99.0670] gram-negative porin family protein [Escherichia coli B107] gram-negative porin family protein [Escherichia coli 09BKT076207] gram-negative porin family protein [Escherichia coli B102] gram-negative porin family protein [Escherichia coli B26-1] gram-negative porin family protein [Escherichia coli B26-2] gram-negative porin family protein [Escherichia coli B28-1] gram-negative porin family protein [Escherichia coli B28-2] gram-negative porin family protein [Escherichia coli B29-1] gram-negative porin family protein [Escherichia coli B29-2] gram-negative porin family protein [Escherichia coli B36-1] gram-negative porin family protein [Escherichia coli B36-2] gram-negative porin family protein [Escherichia coli B7-1] gram-negative porin family protein [Escherichia coli B7-2] gram-negative porin family protein [Escherichia coli B93] gram-negative porin family protein [Escherichia coli B94] gram-negative porin family protein [Escherichia coli B95] gram-negative porin family protein [Escherichia coli 08BKT055439] gram-negative porin family protein [Escherichia coli Bd5610_99] gram-negative porin family protein [Escherichia coli T1840_97] gram-negative porin family protein [Escherichia coli T234_00] gram-negative porin family protein [Escherichia coli 14A] gram-negative porin family protein [Escherichia coli T924_01] gram-negative porin family protein [Escherichia coli 2886-75] gram-negative porin family protein [Escherichia coli B104] gram-negative porin family protein [Escherichia coli B103] gram-negative porin family protein [Escherichia coli B105] gram-negative porin family protein [Escherichia coli B108] gram-negative porin family protein [Escherichia coli B106] gram-negative porin family protein [Escherichia coli B109] gram-negative porin family protein [Escherichia coli B112] gram-negative porin family protein [Escherichia coli B113] gram-negative porin family protein [Escherichia coli B114] gram-negative porin family protein [Escherichia coli B15] gram-negative porin family protein [Escherichia coli B17] gram-negative porin family protein [Escherichia coli B40-2] gram-negative porin family protein [Escherichia coli B40-1] gram-negative porin family protein [Escherichia coli B49-2] gram-negative porin family protein [Escherichia coli B5-2] gram-negative porin family protein [Escherichia coli B83] gram-negative porin family protein [Escherichia coli B84] gram-negative porin family protein [Escherichia coli B85] gram-negative porin family protein [Escherichia coli B86] gram-negative porin family protein [Escherichia coli 08BKT77219] gram-negative porin family protein [Escherichia coli T1282_01] gram-negative porin family protein [Escherichia coli B90] gram-negative porin family protein [Escherichia coli B89] gram-negative porin family protein [Escherichia coli Tx1686] gram-negative porin family protein [Escherichia coli Tx3800] porin [Escherichia coli ATCC BAA-2192] putative outer membrane protein [Escherichia coli SHECO003] putative outer membrane protein [Escherichia coli SHECO002] outer membrane protein [Escherichia coli O157] |
1.71e-102 | 100 | 96.104 | WP_001303549 |
putative outer membrane protein [Escherichia coli O157:H7 str. G5101] H-NS DNA-binding transcriptional dual regulator [Escherichia coli EC96038] gram-negative porin family protein [Escherichia coli 10.0869] gram-negative porin family protein [Escherichia coli PA48] |
1.71e-102 | 100 | 96.104 | EFX11199 |
porin, partial [Escherichia coli] |
1.8e-102 | 100 | 98.052 | WP_024218266 |
outer membrane protein C [Escherichia coli DEC3B] H-NS DNA-binding transcriptional dual regulator [Escherichia coli FDA505] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA5] H-NS DNA-binding transcriptional dual regulator [Escherichia coli PA40] |
1.88e-102 | 100 | 96.104 | EHU60268 |
outer membrane protein, partial [Escherichia coli 908585] |
1.89e-102 | 100 | 98.052 | ESD85225 |
putative outer membrane protein [Escherichia coli] |
2.06e-102 | 99 | 96.732 | STM38477 |
porin, partial [Escherichia coli] |
2.17e-102 | 100 | 98.052 | WP_024217298 |
porin [Escherichia coli] |
2.37e-102 | 100 | 98.052 | RBV42502 |
porin [Escherichia coli] |
2.38e-102 | 100 | 98.052 | WP_097515685 |
porin [Escherichia coli] |
2.57e-102 | 100 | 96.104 | MHT60327 |
porin [Escherichia coli] |
2.59e-102 | 100 | 96.104 | MXG92401 |
porin [Escherichia sp. E3659] porin [Escherichia sp. E3659] porin [Escherichia sp. E3659] |
2.59e-102 | 100 | 98.701 | WP_135487624 |
MULTISPECIES: porin [unclassified Escherichia] porin [Escherichia sp. E1V33] porin [Escherichia sp. E1S7] |
2.59e-102 | 100 | 98.701 | WP_130236740 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
2.61e-102 | 100 | 98.052 | OSC21502 |
Gram-negative porin [Escherichia coli MS 182-1] putative outer membrane protein YedS [Escherichia coli H420] porin [Escherichia coli] |
2.64e-102 | 100 | 98.052 | EFK03211 |
porin, partial [Escherichia coli] |
2.72e-102 | 100 | 98.052 | WP_024217931 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
2.77e-102 | 100 | 98.052 | WP_046123026 |
porin [Escherichia coli] |
2.86e-102 | 100 | 98.701 | MHW77309 |
MULTISPECIES: porin [Enterobacteriaceae] outer membrane protein S1 [Escherichia coli KTE236] outer membrane protein S1 [Escherichia coli KTE237] outer membrane protein S1 [Escherichia coli KTE80] outer membrane protein S1 [Escherichia coli KTE199] outer membrane protein S1 [Escherichia coli KTE121] outer membrane porin OmpK36 [Escherichia coli HVH 41 (4-2677849)] outer membrane porin OmpK36 [Escherichia coli HVH 113 (4-7535473)] outer membrane porin OmpK36 [Escherichia coli HVH 140 (4-5894387)] outer membrane porin OmpK36 [Escherichia coli HVH 189 (4-3220125)] outer membrane porin OmpK36 [Escherichia coli UMEA 3033-1] outer membrane protein N [Escherichia coli 1-110-08_S4_C1] porin [Escherichia coli O15:H18 str. K1516] |
2.89e-102 | 100 | 98.052 | WP_001551287 |
porin [Escherichia coli] |
2.96e-102 | 100 | 98.052 | EAB0957998 |
porin [Escherichia coli] porin [Escherichia coli FAP1] outer membrane protein S1 [Escherichia coli H494] outer membrane protein S1 [Escherichia coli KTE50] outer membrane protein S1 [Escherichia coli KTE202] outer membrane protein S1 [Escherichia coli KTE125] Porin OmpN [Escherichia coli O08] outer membrane porin OmpK36 [Escherichia coli HVH 43 (4-2173468)] outer membrane porin OmpK36 [Escherichia coli HVH 44 (4-2298570)] outer membrane porin OmpK36 [Escherichia coli HVH 115 (4-4465989)] outer membrane porin OmpK36 [Escherichia coli HVH 115 (4-4465997)] outer membrane porin OmpK36 [Escherichia coli HVH 182 (4-0985554)] outer membrane porin OmpK36 [Escherichia coli KOEGE 131 (358a)] outer membrane porin OmpK36 [Escherichia coli UMEA 3065-1] outer membrane porin OmpK36 [Escherichia coli UMEA 3144-1] outer membrane porin OmpK36 [Escherichia coli HVH 136 (4-5970458)] outer membrane protein N [Escherichia coli 1-176-05_S1_C1] outer membrane protein N [Escherichia coli 1-176-05_S1_C3] outer membrane protein N [Escherichia coli 1-176-05_S1_C2] outer membrane protein N [Escherichia coli 4-203-08_S1_C1] outer membrane protein N [Escherichia coli 3-475-03_S1_C2] outer membrane protein N [Escherichia coli 4-203-08_S1_C3] outer membrane protein N [Escherichia coli 4-203-08_S1_C2] Porin OmpN [Escherichia coli VL2732] porin OmpC [Shigella sonnei] |
2.99e-102 | 100 | 98.052 | WP_000824408 |
porin [Escherichia coli] Porin OmpN [Escherichia coli DORA_A_5_14_21] putative outer membrane protein YedS [Escherichia coli TA255] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
3.02e-102 | 100 | 98.052 | WP_024041882 |
porin, partial [Escherichia coli] |
3.03e-102 | 100 | 98.052 | WP_113976053 |
MULTISPECIES: porin [Escherichia] outer membrane protein N [Escherichia coli 2-011-08_S1_C1] |
3.26e-102 | 100 | 98.701 | WP_032303273 |
porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] |
3.3e-102 | 100 | 98.052 | MWM69587 |
porin [Escherichia sp. MOD1-EC5495] |
3.64e-102 | 100 | 98.052 | WP_105285070 |
porin [Escherichia coli] outer membrane pore protein [Escherichia coli] |
3.8e-102 | 100 | 98.052 | WP_137444526 |
MULTISPECIES: porin [Enterobacteriaceae] porin [Escherichia coli] porin [Shigella boydii] porin [Escherichia coli] |
5.24e-102 | 100 | 98.701 | WP_104773811 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] |
5.24e-102 | 100 | 99.351 | WP_089627256 |
outer membrane protein yedS [Escherichia coli FVEC1412] outer membrane protein yedS [Escherichia coli FVEC1302] outer membrane protein [Escherichia coli 907713] outer membrane protein [Escherichia coli 907715] outer membrane protein [Escherichia coli 908522] outer membrane protein [Escherichia coli 908521] outer membrane protein [Escherichia coli 908616] outer membrane protein [Escherichia coli] Porin OmpN [Escherichia coli UMN026] |
5.57e-102 | 100 | 98.052 | EFF00681 |
porin, partial [Escherichia coli] |
5.91e-102 | 100 | 97.403 | WP_106376441 |
porin [Escherichia coli] porin OmpN [Escherichia coli UMN026] outer membrane protein N [Escherichia coli STEC_C165-02] outer membrane protein S1 [Escherichia coli KTE2] outer membrane protein S1 [Escherichia coli KTE26] outer membrane protein S1 [Escherichia coli KTE181] outer membrane protein S1 [Escherichia coli KTE235] outer membrane protein S1 [Escherichia coli KTE83] outer membrane protein S1 [Escherichia coli KTE116] outer membrane protein S1 [Escherichia coli KTE54] outer membrane protein S1 [Escherichia coli KTE78] outer membrane protein S1 [Escherichia coli KTE79] outer membrane protein S1 [Escherichia coli KTE158] outer membrane protein S1 [Escherichia coli KTE190] outer membrane protein S1 [Escherichia coli KTE105] outer membrane protein S1 [Escherichia coli KTE122] outer membrane protein S1 [Escherichia coli KTE82] outer membrane protein S1 [Escherichia coli KTE200] outer membrane protein S1 [Escherichia coli KTE68] outer membrane protein S1 [Escherichia coli KTE1] outer membrane porin OmpK36 [Escherichia coli HVH 10 (4-6832164)] outer membrane porin OmpK36 [Escherichia coli HVH 22 (4-2258986)] outer membrane porin OmpK36 [Escherichia coli HVH 29 (4-3418073)] outer membrane porin OmpK36 [Escherichia coli HVH 45 (4-3129918)] outer membrane porin OmpK36 [Escherichia coli HVH 63 (4-2542528)] outer membrane porin OmpK36 [Escherichia coli HVH 69 (4-2837072)] outer membrane porin OmpK36 [Escherichia coli HVH 85 (4-0792144)] outer membrane porin OmpK36 [Escherichia coli HVH 88 (4-5854636)] outer membrane porin OmpK36 [Escherichia coli HVH 106 (4-6881831)] outer membrane porin OmpK36 [Escherichia coli HVH 110 (4-6978754)] outer membrane porin OmpK36 [Escherichia coli HVH 119 (4-6879578)] outer membrane porin OmpK36 [Escherichia coli HVH 122 (4-6851606)] outer membrane porin OmpK36 [Escherichia coli HVH 134 (4-6073441)] outer membrane porin OmpK36 [Escherichia coli HVH 135 (4-4449320)] outer membrane porin OmpK36 [Escherichia coli HVH 133 (4-4466519)] outer membrane porin OmpK36 [Escherichia coli HVH 145 (4-5672112)] outer membrane porin OmpK36 [Escherichia coli HVH 151 (4-5755573)] outer membrane porin OmpK36 [Escherichia coli HVH 163 (4-4697553)] outer membrane porin OmpK36 [Escherichia coli HVH 167 (4-6073565)] outer membrane porin OmpK36 [Escherichia coli HVH 173 (3-9175482)] outer membrane porin OmpK36 [Escherichia coli HVH 183 (4-3205932)] outer membrane porin OmpK36 [Escherichia coli HVH 206 (4-3128229)] outer membrane porin OmpK36 [Escherichia coli HVH 208 (4-3112292)] outer membrane porin OmpK36 [Escherichia coli HVH 215 (4-3008371)] outer membrane porin OmpK36 [Escherichia coli KOEGE 68 (182a)] outer membrane porin OmpK36 [Escherichia coli KOEGE 62 (175a)] outer membrane porin OmpK36 [Escherichia coli KOEGE 73 (195a)] outer membrane porin OmpK36 [Escherichia coli HVH 155 (4-4509048)] outer membrane protein N [Escherichia coli 2-005-03_S3_C2] outer membrane protein S1 [Escherichia coli MGH 58] outer membrane protein N [Escherichia coli 2-316-03_S1_C1] outer membrane protein N [Escherichia coli 2-316-03_S1_C2] putative outer membrane protein YedS [Escherichia coli FVEC1465] |
6.03e-102 | 100 | 98.052 | WP_000824409 |
porin [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] outer membrane pore protein [Escherichia coli] outer membrane pore protein [Escherichia coli] |
6.06e-102 | 100 | 98.052 | WP_089567897 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli 2845650] porin [Escherichia coli O169:H41 str. F9792] porin OmpC [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
6.17e-102 | 100 | 99.351 | WP_001718446 |
porin [Escherichia coli] outer membrane protein S1 [Escherichia coli KTE196] outer membrane protein S1 [Escherichia coli KTE117] outer membrane porin OmpK36 [Escherichia coli UMEA 3124-1] outer membrane protein N [Escherichia coli 2-011-08_S1_C2] porin [Escherichia coli] |
6.19e-102 | 100 | 99.351 | WP_001613326 |
porin OmpC [Escherichia albertii] |
6.7e-102 | 100 | 98.701 | WP_149540338 |
porin [Escherichia albertii] outer membrane protein [Escherichia albertii TW07627] hypothetical protein YedS [Escherichia albertii NBRC 107761] |
6.77e-102 | 100 | 98.701 | WP_000824415 |
gram-negative porin family protein [Escherichia coli 09BKT024447] |
6.79e-102 | 100 | 95.455 | ERE15182 |
porin [Escherichia albertii] |
6.85e-102 | 100 | 98.701 | EAB1455024 |
porin [Escherichia albertii] porin OmpC [Escherichia albertii] porin OmpC [Escherichia albertii] porin [Escherichia albertii] predicted outer membrane pore protein [Escherichia albertii] |
6.85e-102 | 100 | 98.701 | WP_059218642 |
porin [Escherichia albertii] predicted outer membrane pore protein [Escherichia albertii] |
7.23e-102 | 100 | 98.701 | WP_095575791 |
porin [Escherichia albertii] |
7.39e-102 | 100 | 98.701 | WP_059215841 |
porin [Escherichia coli] |
7.89e-102 | 100 | 97.403 | WP_130059142 |
porin [Escherichia coli] |
7.91e-102 | 100 | 99.351 | ORT29990 |
porin OmpC [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] |
8.09e-102 | 100 | 98.052 | WP_047649583 |
porin [Escherichia coli] |
8.43e-102 | 100 | 97.403 | WP_039020691 |
porin [Escherichia coli] outer membrane porin OmpK36 [Escherichia coli UMEA 3718-1] porin [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] |
8.43e-102 | 100 | 98.052 | WP_021577626 |
porin [Escherichia sp. E4702] porin [Escherichia sp. E4702] |
8.61e-102 | 100 | 98.052 | WP_135489142 |
MULTISPECIES: porin [unclassified Escherichia] porin [Escherichia sp. E14V5] porin [Escherichia sp. E14V7] porin [Escherichia sp. E14V10] porin [Escherichia sp. E5028] porin [Escherichia sp. E4208] |
8.8e-102 | 100 | 98.052 | WP_130216441 |
porin [Escherichia coli C] porin [Escherichia coli] |
9.05e-102 | 100 | 97.403 | ARE47254 |
MULTISPECIES: porin [Enterobacteriaceae] outer membrane protein yedS [Escherichia coli E101] porin OmpC [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
9.19e-102 | 100 | 98.052 | WP_000824414 |
porin [Escherichia coli] Porin OmpN [Escherichia coli] |
9.19e-102 | 100 | 97.403 | WP_112794362 |
porin [Escherichia coli] porin [Escherichia coli] |
9.56e-102 | 100 | 98.052 | OTD29067 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] |
9.71e-102 | 100 | 97.403 | WP_074582819 |
porin [Shigella flexneri] porin [Shigella flexneri] |
9.87e-102 | 100 | 97.403 | PAY81022 |
porin [Escherichia coli] outer membrane protein S1 [Escherichia coli KTE193] outer membrane protein S1 [Escherichia coli KTE112] outer membrane porin OmpK36 [Escherichia coli UMEA 3671-1] porin [Escherichia coli] porin OmpC [Escherichia coli] |
9.92e-102 | 100 | 98.052 | WP_001537206 |
MULTISPECIES: porin [Enterobacteriaceae] outer membrane protein N [Escherichia coli 6-319-05_S4_C2] outer membrane protein N [Escherichia coli 6-319-05_S4_C3] putative outer membrane protein YedS [Escherichia coli R424] porin OmpC [Escherichia coli] porin [Escherichia coli] |
9.92e-102 | 100 | 97.403 | WP_000824410 |
porin [Escherichia coli] outer membrane pore protein [Escherichia coli] |
1e-101 | 100 | 97.403 | WP_137497611 |
porin [Escherichia coli] Porin OmpN [Escherichia coli] |
1e-101 | 100 | 98.052 | WP_112044145 |
porin [Escherichia coli] |
1.12e-101 | 100 | 98.052 | WP_097744553 |
porin [Escherichia coli] |
1.12e-101 | 100 | 97.403 | MGS56899 |
porin [Escherichia coli] porin [Shigella sonnei] outer membrane protein S1 [Escherichia coli] outer membrane protein S1 [Escherichia coli] outer membrane protein S1 [Escherichia coli] outer membrane protein S1 [Escherichia coli] |
1.18e-101 | 100 | 97.403 | WP_094249726 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.19e-101 | 100 | 97.403 | WP_097428618 |
porin [Escherichia coli] porin OmpC [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] |
1.26e-101 | 100 | 97.403 | WP_112023830 |
porin [Escherichia coli] |
1.28e-101 | 100 | 97.403 | WP_113440059 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] |
1.29e-101 | 100 | 97.403 | WP_047623682 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] |
1.3e-101 | 100 | 97.403 | WP_097335365 |
putative outer membrane protein YedS [Escherichia coli TA447] |
1.32e-101 | 100 | 99.351 | OSK93589 |
Porin OmpN [Escherichia coli] |
1.33e-101 | 100 | 96.753 | STI12260 |
porin, partial [Escherichia coli] |
1.55e-101 | 100 | 97.403 | WP_089679496 |
porin [Escherichia sp. E1130] porin [Escherichia sp. E1130] |
1.66e-101 | 100 | 98.052 | WP_138211453 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_5 In blautia CP039126.1
Seq (len = 61 ):
MTENQQKLYDFLKSKGGSAHLMDCAMQLDISDEELQLAVNTLVQSGIISKDAYVQPTLRII
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|383626|-1|1942316-1942694
Transkriptom
50.0% of gene length expressed over median expression of contig.
ŝ
9.166003412057155
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_6 In blautia CP039126.1
Seq (len = 761 ):
MGTVFVSAAEEGTGKSTETAGKPELSKKTADSVVLKTKDGYVYGIQENGSKWKWAEDKQYDKTAKTVSFTGLKAETEYVFAGKTKDAETVQDTDTLKVKTEAAAVQTETPKTEEPPKAENTDNNGEINKPQGGDLNTEQTKPEETNKTDTETNTPPSVGETTGSAEGTQDIDKDTTKDTLTDNAGEPKADEPKVDEPKVDEPKVDKPKVDEPKADEPKVDEPKKDESKADDSNKDESKGVESKGEEQKTNSSENKVNDANGLKGSNNANDTLQKATKPNPPVVDKVTDTSVVLKPSSDADKYTYSYKLVLKDNKAKATELINDKGEFTGLTPDTDYLAYIMVKGDSNASPSYADSEWSDAAEVHTLKAAAEKPKAAPKLAEKTDTTIKLDTSTANLEYGVYLDGGNISWNNTGEFKGLTAGKEYEFVTRVKFDKDKQMESPVSDSLKVTTKKAAAAAPEAPVCIGRTENSITLRAVNGQEFAMLENGTPGKWQDSEVFSGLKANTRYSFVTRVKYNPDEAMESKVSSSASGKTIIAFEGSSVTGIEVNGVYDKNTVVNMAANGNGTDNQNPEGQDTRWVPESWKWGSSAKGTWNKSPYTAKLTLNKAGKMELQVVFRLEEYTEKGWTAMTAEKKTITVPFSVKEQYTITASAGSNGKISPSGSVKVMEGNDATFTITPNKGYQISQVTVDGKAVTVKNSKYTFEDVSANHKISVTFKKLTKTVPKTGDTMNMAGYLMLAVLSAGAVFTVLLSAKRKKTNHR
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|3533|1|77695-80044
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
7.751372921724113
unique PSMS
25
unique PSMS
25
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
LPXTG cell wall anchor domain-containing protein [Faecalicatena orotica]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein PMF13cell1_01496 [Blautia producta] |
0.0 | 100 | 98.817 | QBE95970 |
hypothetical protein EV205_11040 [Blautia coccoides] S-layer domain-containing protein [Blautia coccoides] |
0.0 | 100 | 94.612 | TCO61223 |
hypothetical protein [Clostridiales bacterium VE202-06] |
0.0 | 100 | 93.167 | WP_029471061 |
hypothetical protein [Blautia marasmi] |
0.0 | 100 | 74.937 | WP_104803584 |
MULTISPECIES: hypothetical protein [Blautia] |
0.0 | 100 | 74.121 | WP_095174400 |
MULTISPECIES: hypothetical protein [Blautia] hypothetical protein C3R19_07455 [Blautia producta] hypothetical protein DXA40_25565 [Blautia sp. OF01-4LB] hypothetical protein DWV84_22940 [Blautia sp. AF13-16] |
0.0 | 100 | 75.907 | WP_103731561 |
hypothetical protein [Blautia producta] |
0.0 | 100 | 75.777 | WP_148392046 |
MULTISPECIES: hypothetical protein [Blautia] hypothetical protein A4V09_20035 [Blautia sp. YL58] hypothetical protein ADH70_018645 [Blautia coccoides] |
0.0 | 100 | 72.020 | WP_065543922 |
hypothetical protein [Blautia producta] |
0.0 | 100 | 74.903 | WP_033143938 |
hypothetical protein [Blautia producta] |
0.0 | 63 | 99.374 | WP_130180337 |
LPXTG cell wall anchor domain-containing protein [Faecalicatena orotica] LPXTG-motif cell wall-anchored protein [Faecalicatena orotica] LPXTG-motif cell wall anchor domain-containing protein [Faecalicatena orotica] |
6.07e-135 | 99 | 38.781 | WP_109732909 |
MULTISPECIES: LPXTG cell wall anchor domain-containing protein [Clostridiales] LPXTG cell wall anchor domain-containing protein [Clostridium sp. AF19-22AC] |
1.97e-134 | 99 | 39.586 | WP_118617990 |
LPXTG cell wall anchor domain-containing protein [Clostridium sp. D5] |
1.27e-125 | 99 | 36.209 | WP_157134230 |
LPXTG cell wall anchor domain-containing protein [Faecalicatena fissicatena] putative PKD [Clostridium sp. D5] |
3.36e-125 | 99 | 36.209 | WP_009003015 |
MULTISPECIES: LPXTG cell wall anchor domain-containing protein [Clostridiales] LPXTG cell wall anchor domain-containing protein [Eubacterium sp. BIOML-A1] LPXTG cell wall anchor domain-containing protein [Eubacterium sp. BIOML-A2] LPXTG cell wall anchor domain-containing protein [Eubacterium sp. am_0171] Fibronectin type III domain [[Eubacterium] contortum] [Faecalicatena contorta] |
7.22e-120 | 97 | 35.629 | WP_055155001 |
MULTISPECIES: LPXTG cell wall anchor domain-containing protein [Clostridiales] |
2.78e-118 | 97 | 35.271 | WP_050638954 |
LPXTG cell wall anchor domain-containing protein [Faecalicatena contorta] LPXTG cell wall anchor domain-containing protein [Faecalicatena contorta] |
3.05e-115 | 99 | 35.854 | WP_153921432 |
sortase B protein-sorting domain-containing protein [Firmicutes bacterium] |
1.87e-114 | 99 | 35.097 | WP_147578362 |
LPXTG cell wall anchor domain-containing protein [Faecalicatena fissicatena] |
3.67e-108 | 99 | 40.110 | WP_157290621 |
LPXTG cell wall anchor domain-containing protein [Faecalicatena fissicatena] |
4.01e-22 | 99 | 30.480 | WP_157290621 |
LPXTG cell wall anchor domain-containing protein [Hungatella hathewayi] LPXTG cell wall anchor domain-containing protein [Hungatella hathewayi] |
2.71e-99 | 99 | 40.162 | WP_025656602 |
LPXTG cell wall anchor domain-containing protein [Hungatella hathewayi] LPXTG cell wall anchor domain-containing protein [Hungatella hathewayi] |
2.5e-26 | 99 | 30.909 | WP_025656602 |
hypothetical protein [Bariatricus massiliensis] |
1.88e-84 | 83 | 42.327 | WP_066737546 |
hypothetical protein [Bariatricus massiliensis] |
1.17e-17 | 83 | 36.634 | WP_066737546 |
hypothetical protein [Bariatricus massiliensis] |
6.01e-07 | 83 | 34.307 | WP_066737546 |
LPXTG cell wall anchor domain-containing protein [Frisingicoccus caecimuris] LPXTG-motif cell wall-anchored protein [Frisingicoccus caecimuris] |
4.68e-82 | 97 | 41.935 | WP_132092759 |
LPXTG cell wall anchor domain-containing protein [Frisingicoccus caecimuris] LPXTG-motif cell wall-anchored protein [Frisingicoccus caecimuris] |
3.78e-15 | 97 | 32.648 | WP_132092759 |
hypothetical protein [Lachnospiraceae bacterium] |
6.98e-81 | 76 | 42.342 | WP_158426809 |
hypothetical protein [Lachnospiraceae bacterium] |
1.19e-10 | 76 | 40.972 | WP_158426809 |
hypothetical protein [Desulfatirhabdium butyrativorans] |
1.94e-16 | 14 | 53.125 | WP_084503072 |
hypothetical protein [Desulfatirhabdium butyrativorans] |
2.57e-11 | 14 | 43.878 | WP_084503072 |
hypothetical protein [Desulfatirhabdium butyrativorans] |
3.42e-06 | 14 | 44.595 | WP_084503072 |
hypothetical protein [Oscillospiraceae bacterium VE202-24] |
2.47e-16 | 18 | 40.244 | WP_025544089 |
S8 family serine peptidase [Bacillus sp. FJAT-25509] hypothetical protein AN960_04070 [Bacillus sp. FJAT-25509] |
2.55e-16 | 13 | 54.444 | WP_056467219 |
S8 family serine peptidase [Bacillus sp. FJAT-25509] hypothetical protein AN960_04070 [Bacillus sp. FJAT-25509] |
9.09e-11 | 13 | 42.105 | WP_056467219 |
S8 family serine peptidase [Bacillus sp. FJAT-25509] hypothetical protein AN960_04070 [Bacillus sp. FJAT-25509] |
1.32e-09 | 13 | 50.000 | WP_056467219 |
S8 family serine peptidase [Bacillus sp. AFS029533] hypothetical protein COE53_01895 [Bacillus sp. AFS029533] |
3.52e-16 | 12 | 54.444 | WP_098947350 |
S8 family serine peptidase [Bacillus sp. AFS029533] hypothetical protein COE53_01895 [Bacillus sp. AFS029533] |
3.83e-12 | 12 | 44.944 | WP_098947350 |
S8 family serine peptidase [Bacillus sp. AFS029533] hypothetical protein COE53_01895 [Bacillus sp. AFS029533] |
4.37e-11 | 12 | 47.436 | WP_098947350 |
S8 family serine peptidase [Bacillus sp. AFS029533] hypothetical protein COE53_01895 [Bacillus sp. AFS029533] |
6.06e-09 | 12 | 50.000 | WP_098947350 |
hypothetical protein EIO64_06920 [Dysosmobacter welbionis] |
5.41e-16 | 18 | 40.244 | QCI58990 |
hypothetical protein [Oscillibacter sp.] |
5.6e-16 | 18 | 40.244 | MUU10770 |
Endo-1%2C4-beta-xylanase A precursor [uncultured Oscillibacter sp.] |
5.73e-16 | 18 | 40.244 | SCJ18499 |
Endo-1%2C4-beta-xylanase A precursor [uncultured Oscillibacter sp.] |
5.88e-16 | 18 | 40.244 | SCI05547 |
hypothetical protein [Dysosmobacter welbionis] |
5.98e-16 | 18 | 40.244 | WP_158629721 |
hypothetical protein A4E63_03428 [Syntrophorhabdus sp. PtaU1.Bin050] |
6.05e-16 | 14 | 48.000 | OPY64531 |
hypothetical protein A4E63_03428 [Syntrophorhabdus sp. PtaU1.Bin050] |
5.75e-14 | 14 | 50.538 | OPY64531 |
hypothetical protein [Oscillibacter sp. PEA192] |
6.05e-16 | 18 | 40.244 | WP_119311624 |
leucine-rich repeat protein [Sunxiuqinia elliptica] |
6.13e-16 | 31 | 36.316 | WP_093919299 |
leucine-rich repeat protein [Sunxiuqinia elliptica] |
2.99e-14 | 31 | 33.058 | WP_093919299 |
leucine-rich repeat protein [Sunxiuqinia elliptica] |
2.62e-13 | 31 | 38.889 | WP_093919299 |
leucine-rich repeat protein [Sunxiuqinia elliptica] |
6.68e-12 | 31 | 34.359 | WP_093919299 |
leucine-rich repeat protein [Sunxiuqinia elliptica] |
5.25e-10 | 31 | 34.392 | WP_093919299 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_7 In ecoli U00096.3
Seq (len = 158 ):
IVECTGFYTSAEKSQAHLDAGAKKVLISAPAGEMKTIVYNVNDDTLDGNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYTGTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPELSGKLKGHAQRVPVKTGSVTELVSILGKK
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|285462|-1|1489963-1490596
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
7.375511637486551
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
6.05e-111 | 100 | 100.000 | MXI77282 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
6.92e-111 | 100 | 100.000 | MQK37109 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
9.39e-111 | 100 | 100.000 | EAC1412763 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.27e-110 | 100 | 100.000 | ONK52349 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.6e-110 | 100 | 100.000 | ORS49628 |
aldehyde dehydrogenase, partial [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.92e-110 | 100 | 100.000 | WP_058905268 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
2.23e-110 | 100 | 100.000 | WP_139570828 |
hypothetical protein [Escherichia coli] |
2.55e-110 | 100 | 100.000 | WP_151300155 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] hypothetical protein ENE68_11410 [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
3.31e-110 | 100 | 100.000 | WP_077248972 |
aldehyde dehydrogenase, partial [Escherichia coli] |
3.41e-110 | 100 | 99.367 | WP_146711817 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
3.5e-110 | 100 | 100.000 | MWR88535 |
hypothetical protein [Escherichia coli] |
4.15e-110 | 100 | 100.000 | WP_124353926 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
4.39e-110 | 100 | 99.367 | KAB2427476 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli M863] |
5.03e-110 | 100 | 100.000 | EGB59458 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.25e-110 | 100 | 100.000 | OKT15572 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.28e-110 | 100 | 100.000 | OYJ67758 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.37e-110 | 100 | 100.000 | SPW59353 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.6e-110 | 100 | 100.000 | MJJ91983 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.73e-110 | 100 | 100.000 | WP_116986382 |
unnamed protein product type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.76e-110 | 100 | 100.000 | WP_072186464 |
glyceraldehyde-3-phosphate dehydrogenase C (GAPDH-C) [Escherichia coli TA271] |
5.97e-110 | 100 | 100.000 | EGI37267 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
6.08e-110 | 100 | 100.000 | MXH42125 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
6.57e-110 | 100 | 100.000 | WP_137574167 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase, type I [Shigella sonnei str. Moseley] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
6.94e-110 | 100 | 100.000 | WP_000048666 |
aldehyde dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE154] |
7.06e-110 | 100 | 99.367 | WP_001619408 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella dysenteriae] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella dysenteriae] |
7.48e-110 | 100 | 99.367 | MJQ33309 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
7.48e-110 | 100 | 100.000 | MJC17429 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
7.55e-110 | 100 | 100.000 | WP_113316935 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] |
7.58e-110 | 100 | 100.000 | WP_052993399 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
7.72e-110 | 100 | 100.000 | CTS54638 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] |
7.8e-110 | 100 | 100.000 | WP_052970351 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
8.21e-110 | 100 | 100.000 | WP_117002569 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli 4_1_47FAA] |
8.26e-110 | 100 | 100.000 | EHP64046 |
aldehyde dehydrogenase, partial [Shigella sonnei] |
8.29e-110 | 100 | 100.000 | WP_077137296 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
8.57e-110 | 100 | 100.000 | MHN81322 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] |
8.84e-110 | 100 | 100.000 | WP_146759952 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
8.9e-110 | 100 | 100.000 | GCO25561 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli O111:H11 str. CVM9545] |
8.96e-110 | 100 | 100.000 | WP_000048695 |
aldehyde dehydrogenase, partial [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
9.03e-110 | 100 | 99.367 | WP_095373986 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Shigella sonnei 53G] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
9.3e-110 | 100 | 100.000 | APL03035 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
9.36e-110 | 100 | 100.000 | EAA1441347 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
9.41e-110 | 100 | 100.000 | WP_129741159 |
glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli 3006] |
9.76e-110 | 100 | 100.000 | EKI40216 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.03e-109 | 100 | 100.000 | STI01348 |
aldehyde dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C (GAPDH-C) [Escherichia coli TA143] |
1.05e-109 | 100 | 100.000 | WP_001314708 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.09e-109 | 100 | 100.000 | RVE11927 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.09e-109 | 100 | 100.000 | WP_047082456 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.11e-109 | 100 | 100.000 | WP_139498949 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.24e-109 | 100 | 100.000 | MGH10621 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.27e-109 | 100 | 100.000 | WP_149857495 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.4e-109 | 100 | 99.367 | MWM17498 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella dysenteriae] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella dysenteriae] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella dysenteriae] |
1.47e-109 | 100 | 99.367 | WP_119169654 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
1.51e-109 | 100 | 100.000 | GCX58642 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.51e-109 | 100 | 100.000 | WP_126875247 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella dysenteriae] |
1.52e-109 | 100 | 99.367 | WP_139354518 |
hypothetical protein [Escherichia coli] |
1.55e-109 | 100 | 99.367 | MWU13329 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.56e-109 | 100 | 100.000 | WP_115735386 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella dysenteriae] |
1.58e-109 | 100 | 99.367 | WP_139354381 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.59e-109 | 100 | 100.000 | WP_097506810 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella dysenteriae] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella dysenteriae] |
1.6e-109 | 100 | 99.367 | WP_119178578 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
1.64e-109 | 100 | 100.000 | WP_137529423 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.64e-109 | 100 | 100.000 | WP_100023969 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.67e-109 | 100 | 100.000 | WP_129753747 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
1.69e-109 | 100 | 100.000 | WP_052990136 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.69e-109 | 99 | 100.000 | EAA0858562 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.71e-109 | 100 | 100.000 | MLH94649 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.71e-109 | 100 | 100.000 | WP_089625837 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
1.73e-109 | 100 | 100.000 | WP_137537593 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.73e-109 | 100 | 100.000 | WP_047643017 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.73e-109 | 100 | 100.000 | WP_053275973 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.73e-109 | 100 | 100.000 | MHR99186 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.74e-109 | 100 | 100.000 | WP_061350134 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.75e-109 | 100 | 100.000 | WP_158145741 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.76e-109 | 100 | 100.000 | WP_069198297 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.77e-109 | 100 | 100.000 | WP_115737988 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.78e-109 | 100 | 100.000 | WP_097422546 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.78e-109 | 100 | 100.000 | WP_097735945 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
1.78e-109 | 100 | 100.000 | WP_097307292 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] Glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.78e-109 | 100 | 100.000 | WP_044341072 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.78e-109 | 100 | 100.000 | WP_112013991 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.78e-109 | 100 | 100.000 | WP_096184938 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.78e-109 | 100 | 100.000 | WP_097305874 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.8e-109 | 100 | 100.000 | WP_151276217 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.8e-109 | 100 | 100.000 | WP_029487877 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.8e-109 | 100 | 100.000 | WP_147726517 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.86e-109 | 100 | 100.000 | WP_097404037 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
1.89e-109 | 100 | 100.000 | WP_137580352 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.89e-109 | 100 | 100.000 | WP_146759434 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.89e-109 | 100 | 100.000 | WP_151396835 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.89e-109 | 100 | 100.000 | WP_115762201 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli P0302308.11] |
1.91e-109 | 100 | 100.000 | WP_001494174 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli P0299438.11] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli P0299438.3] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli P0299438.5] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli P0299438.6] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli P0299438.7] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli P0299438.8] |
1.91e-109 | 100 | 100.000 | WP_001460868 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli O8:H8] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.91e-109 | 100 | 100.000 | WP_096306728 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli H588] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] Glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.91e-109 | 100 | 100.000 | WP_085455333 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
1.91e-109 | 100 | 100.000 | GCS60203 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.93e-109 | 100 | 100.000 | MGT46380 |
NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Klebsiella pneumoniae IS22] |
1.95e-109 | 100 | 100.000 | CDK76291 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.95e-109 | 100 | 100.000 | WP_115737688 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.95e-109 | 100 | 100.000 | WP_024705297 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.95e-109 | 100 | 100.000 | WP_097451057 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{translation on same strand (frameshift candidate)}
Candidate nov_psm6_8 In ecoli U00096.3
Seq (len = 486 ):
MGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|181168|-1|4297221-4298946
Transkriptom
98.0% of gene length expressed over median expression of contig.
ŝ
10.180894967458501
unique PSMS
14
unique PSMS
14
Genomic Context
Candidate has annotation on SAME strand. Which has 10 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
formate dehydrogenase subunit alpha [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_098723138 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_085693694 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077870206 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_100033175 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077817968 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077636244 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_128452098 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077776952 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077767179 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077885425 |
formate dehydrogenase subunit alpha [Shigella sonnei] |
0.0 | 100 | 100.000 | WP_077794266 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_149016952 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_126851899 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_112933764 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_126655521 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_140039644 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | EAA3482290 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_109864739 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077254887 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_115204175 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077882165 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_098733582 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | EAC1504786 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_136747903 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077818822 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_136147602 |
formate dehydrogenase subunit alpha [Shigella sonnei] |
0.0 | 100 | 100.000 | WP_077814718 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_097437760 |
formate dehydrogenase subunit alpha, partial [Shigella sonnei] |
0.0 | 100 | 100.000 | WP_077903977 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_137471068 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_121855562 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077887780 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_130563702 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_106735784 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077761816 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077881645 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_139942612 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_137593972 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_097311572 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_096315824 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_140035463 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_100041044 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_126655174 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_113771743 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_149019110 |
formate dehydrogenase-H%2C selenopolypeptide subunit [Shigella sonnei] formate dehydrogenase-H, selenopolypeptide subunit [Shigella sonnei] formate dehydrogenase-H, selenopolypeptide subunit [Shigella sonnei] formate dehydrogenase-H, selenopolypeptide subunit [Shigella sonnei] |
0.0 | 100 | 100.000 | CSO14151 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | EAB0853542 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077248962 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_085454565 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077249950 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077637275 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_089586791 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_114213178 |
formate dehydrogenase subunit alpha, partial [Escherichia coli] |
0.0 | 100 | 100.000 | WP_119125963 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077581121 |
formate dehydrogenase subunit alpha [Shigella sonnei] |
0.0 | 100 | 100.000 | WP_077814623 |
formate dehydrogenase, alpha subunit [Shigella sonnei 3233-85] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.6] formate dehydrogenase, alpha subunit [Escherichia coli] |
0.0 | 100 | 100.000 | EIQ38635 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_137542526 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077631777 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_077879149 |
MULTISPECIES: formate dehydrogenase subunit alpha [Proteobacteria] formate dehydrogenase H [Escherichia coli str. K-12 substr. MG1655] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli IAI39] RecName: Full=Formate dehydrogenase H; AltName: Full=Formate dehydrogenase-H subunit alpha; Short=FDH-H; AltName: Full=Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide [Escherichia coli K-12] formate dehydrogenase H, alpha subunit, selenocysteine-containing [Escherichia coli HS] formate dehydrogenase, alpha subunit [Escherichia coli ATCC 8739] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli str. K-12 substr. DH10B] formate dehydrogenase H, alpha subunit, selenocysteine-containing [Escherichia coli SMS-3-5] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli BW2952] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli B str. REL606] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli W] formate dehydrogenase, alpha subunit [Escherichia coli KO11FL] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli BW25113] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli ER2796] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli 1303] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli ECC-1470] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli C] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O104:H4] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O104:H21 str. CFSAN002236] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O121:H19] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O121 str. RM8352] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O103 str. RM8385] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O26 str. RM8426] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O43 str. RM10042] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O26 str. RM10386] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O145 str. RM9872] formate dehydrogenase subunit alpha [Escherichia coli O157:H7] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O103] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O26] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O145] formate dehydrogenase H, alpha subunit, selenocysteine-containing [Escherichia coli 53638] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium TzEc077] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium TzEc058] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium TzEc084] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium TzEc052] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium TzEc051] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium TzEc013] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium 8376wB8] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium 8376wD7] formate dehydrogenase subunit alpha [Enterobacteriaceae bacterium 8376wG6] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O157] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O113:H21] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O91:H21] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O103:H2] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O45:H2] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O145:NM] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O26:H11] formate dehydrogenase subunit alpha [Escherichia coli O1:H42] formate dehydrogenase subunit alpha [Escherichia coli 042] formate dehydrogenase subunit alpha [Escherichia coli O80:H26] formate dehydrogenase subunit alpha [Escherichia coli O16:H48] formate dehydrogenase subunit alpha [Escherichia coli O22:H8] formate dehydrogenase subunit alpha [Escherichia coli HT115] formate dehydrogenase subunit alpha [Escherichia coli O177] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli IAI1] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O127:H6 str. E2348/69] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli 55989] formate dehydrogenase H alph subunit (formate-hydrogen-lyase-linked selenocysteine-containing polypeptide) [Escherichia coli ETEC H10407] selenopolypeptide subunit of formate dehydrogenase H [Escherichia coli chi7122] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli str. K-12 substr. MC4100] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli str. K-12 substr. W3110] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O26:H11 str. 11368] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O103:H2 str. 12009] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli str. K-12 substr. MDS42] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O145:H28] formate dehydrogenase N subunit alpha, selenocysteine-containing [Escherichia coli O8:H8] formate dehydrogenase N subunit alpha, selenocysteine-containing [Shigella sp.] |
0.0 | 100 | 100.000 | WP_001300547 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_077895609 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_094030439 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_096178308 |
MULTISPECIES: formate dehydrogenase subunit alpha [Enterobacteriaceae] formate dehydrogenase subunit alpha [Shigella sonnei] formate dehydrogenase subunit alpha [Shigella sonnei] formate dehydrogenase subunit alpha [Shigella sonnei] formate dehydrogenase subunit alpha [Shigella sonnei] formate dehydrogenase subunit alpha [Shigella sonnei] |
0.0 | 100 | 100.000 | WP_077449854 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_097746789 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_135171909 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077825812 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_077747115 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_097475174 |
Chain A, Formate Dehydrogenase H [Escherichia coli] Chain A, Formate Dehydrogenase H [Escherichia coli] Chain A, Formate Dehydrogenase H [Escherichia coli] Chain X, Formate dehydrogenase H [Escherichia coli] |
0.0 | 100 | 100.000 | 1AA6_A |
formate dehydrogenase subunit alpha [Shigella sonnei] |
0.0 | 100 | 100.000 | WP_112489329 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077818103 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_095079513 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_130060340 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_089659807 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_089641900 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_137465540 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077880696 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_134234906 |
formate dehydrogenase [Escherichia coli] |
0.0 | 100 | 100.000 | AAA23754 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_077637575 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | MMU46631 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077854857 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_094281820 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077874602 |
formate dehydrogenase H [Escherichia coli KTE107] formate dehydrogenase [Escherichia coli] formate dehydrogenase [Escherichia coli] |
0.0 | 100 | 100.000 | EOW30312 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_103119199 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077899142 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_109114172 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_106914006 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077822683 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia sp. HH41S] |
0.0 | 100 | 100.000 | WP_089679047 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | MGH21712 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077881855 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O104:H4 str. 2011C-3493] formate dehydrogenase H, alpha subunit, selenocysteine-containing [Escherichia coli O139:H28 str. E24377A] formate dehydrogenase, alpha subunit FdhA [Escherichia coli UMNK88] formate dehydrogenase, alpha subunit [Escherichia coli UMNF18] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O55:H7 str. RM12579] Formate dehydrogenase H [Escherichia coli P12b] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli W] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O104:H4 str. 2009EL-2050] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O104:H4 str. 2009EL-2071] formate dehydrogenase-H subunit alpha [Escherichia coli APEC O78] hypothetical protein LY180_21420 [Escherichia coli LY180] Formate dehydrogenase H [Escherichia coli O145:H28 str. RM13514] Formate dehydrogenase H / selenocysteine-containing [Escherichia coli O145:H28 str. RM13516] Formate dehydrogenase H [Escherichia coli O145:H28 str. RM12761] Formate dehydrogenase H [Escherichia coli O145:H28 str. RM12581] formate dehydrogenase [Escherichia coli KLY] formate dehydrogenase [Escherichia coli B7A] formate dehydrogenase [Escherichia coli FAP1] formate dehydrogenase [Escherichia coli str. K-12 substr. MG1655] formate dehydrogenase [Escherichia coli K-12] formate dehydrogenase [Escherichia coli O104:H4 str. C227-11] formate dehydrogenase-H [Escherichia coli PCN061] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli ACN001] formate dehydrogenase [Escherichia coli str. Sanji] formate dehydrogenase subunit alpha [Escherichia coli str. K-12 substr. W3110] selenoprotein anaerobic dehydrogenase, selenopolypeptide subunit C-terminus [Escherichia coli NCCP15648] formate dehydrogenase subunit alpha [Escherichia coli O91 str. RM7190] formate dehydrogenase, alpha subunit [Escherichia coli MS 196-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 175-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 84-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 115-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 182-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 116-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 187-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 119-7] formate dehydrogenase, alpha subunit [Escherichia coli MS 107-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 124-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 78-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 146-1] formate dehydrogenase, alpha subunit [Escherichia coli MS 145-7] formate dehydrogenase, alpha subunit [Escherichia coli 1827-70] formate dehydrogenase, alpha subunit [Escherichia coli MS 85-1] formate dehydrogenase, alpha subunit [Escherichia coli 3431] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O157:H7 str. G5101] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O157:H- str. 493-89] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O157:H- str. H 2687] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O55:H7 str. 3256-97] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O55:H7 str. USDA 5905] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O157:H7 str. LSU-61] formate dehydrogenase, alpha subunit [Escherichia coli EPECa14] formate dehydrogenase, alpha subunit [Escherichia coli E128010] formate dehydrogenase, alpha subunit [Shigella sonnei 53G] formate dehydrogenase, alpha subunit [Escherichia coli LT-68] formate dehydrogenase, alpha subunit [Escherichia coli OK1357] formate dehydrogenase [Escherichia coli E1520] formate dehydrogenase [Escherichia coli E482] formate dehydrogenase [Escherichia coli H120] formate dehydrogenase [Escherichia coli H489] formate dehydrogenase [Escherichia coli TA007] formate dehydrogenase [Escherichia coli TW10509] formate dehydrogenase, alpha subunit [Escherichia coli MS 117-3] formate dehydrogenase [Escherichia coli E1167] formate dehydrogenase, alpha subunit [Escherichia coli H736] formate dehydrogenase, alpha subunit [Escherichia coli M718] formate dehydrogenase, alpha subunit [Escherichia coli TA143] formate dehydrogenase, alpha subunit [Escherichia coli TA271] formate dehydrogenase, alpha subunit [Escherichia coli TA280] formate dehydrogenase, alpha subunit [Escherichia coli H591] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O104:H4 str. 01-09591] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O104:H4 str. LB226692] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli XH140A] formate dehydrogenase, alpha subunit [Escherichia coli MS 79-10] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli XH001] formate dehydrogenase, alpha subunit [Escherichia coli STEC_B2F1] formate dehydrogenase, alpha subunit [Escherichia coli STEC_94C] formate dehydrogenase, alpha subunit [Escherichia coli 3030-1] formate dehydrogenase, alpha subunit [Escherichia coli STEC_DG131-3] formate dehydrogenase, alpha subunit [Escherichia coli STEC_EH250] formate dehydrogenase, alpha subunit [Escherichia coli G58-1] formate dehydrogenase, alpha subunit [Escherichia coli STEC_MHI813] formate dehydrogenase, alpha subunit [Escherichia coli STEC_S1191] formate dehydrogenase, alpha subunit [Escherichia coli TX1999] formate dehydrogenase H [Escherichia coli O104:H4 str. C236-11] formate dehydrogenase H [Escherichia coli O104:H4 str. 04-8351] formate dehydrogenase H [Escherichia coli O104:H4 str. 09-7901] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-3677] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4404] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4522] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4623] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4632 C1] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4632 C2] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4632 C3] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4632 C4] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-4632 C5] formate dehydrogenase H [Escherichia coli H494] formate dehydrogenase H [Escherichia coli TA124] formate dehydrogenase H [Escherichia coli B093] formate dehydrogenase H [Escherichia coli E101] formate dehydrogenase H [Escherichia coli 4_1_47FAA] formate dehydrogenase, alpha subunit [Escherichia coli DEC3F] formate dehydrogenase, alpha subunit [Escherichia coli DEC5A] formate dehydrogenase, alpha subunit [Escherichia coli DEC5B] formate dehydrogenase, alpha subunit [Escherichia coli DEC5C] formate dehydrogenase, alpha subunit [Escherichia coli DEC5D] formate dehydrogenase, alpha subunit [Escherichia coli DEC5E] formate dehydrogenase, alpha subunit [Escherichia coli DEC6B] formate dehydrogenase, alpha subunit [Escherichia coli DEC6A] formate dehydrogenase, alpha subunit [Escherichia coli DEC6C] formate dehydrogenase, alpha subunit [Escherichia coli DEC6D] formate dehydrogenase, alpha subunit [Escherichia coli DEC6E] formate dehydrogenase, alpha subunit [Escherichia coli DEC7A] formate dehydrogenase, alpha subunit [Escherichia coli DEC7C] formate dehydrogenase, alpha subunit [Escherichia coli DEC7D] formate dehydrogenase, alpha subunit [Escherichia coli DEC7B] formate dehydrogenase, alpha subunit [Escherichia coli DEC7E] formate dehydrogenase, alpha subunit [Escherichia coli DEC8C] formate dehydrogenase, alpha subunit [Escherichia coli DEC8D] formate dehydrogenase, alpha subunit [Escherichia coli DEC8E] formate dehydrogenase, alpha subunit [Escherichia coli DEC9A] formate dehydrogenase, alpha subunit [Escherichia coli DEC9B] formate dehydrogenase, alpha subunit [Escherichia coli DEC9C] formate dehydrogenase, alpha subunit [Escherichia coli DEC9D] formate dehydrogenase, alpha subunit [Escherichia coli DEC9E] formate dehydrogenase, alpha subunit [Escherichia coli DEC10A] formate dehydrogenase, alpha subunit [Escherichia coli DEC10B] formate dehydrogenase, alpha subunit [Escherichia coli DEC10C] formate dehydrogenase, alpha subunit [Escherichia coli DEC10D] formate dehydrogenase, alpha subunit [Escherichia coli DEC10E] formate dehydrogenase, alpha subunit [Escherichia coli DEC11A] formate dehydrogenase, alpha subunit [Escherichia coli DEC10F] formate dehydrogenase, alpha subunit [Escherichia coli DEC11B] formate dehydrogenase, alpha subunit [Escherichia coli DEC11D] formate dehydrogenase, alpha subunit [Escherichia coli DEC11C] formate dehydrogenase, alpha subunit [Escherichia coli DEC11E] formate dehydrogenase, alpha subunit [Escherichia coli DEC12B] formate dehydrogenase, alpha subunit [Escherichia coli DEC12A] formate dehydrogenase, alpha subunit [Escherichia coli DEC12C] formate dehydrogenase, alpha subunit [Escherichia coli DEC12D] formate dehydrogenase, alpha subunit [Escherichia coli DEC12E] formate dehydrogenase, alpha subunit [Escherichia coli DEC13A] formate dehydrogenase, alpha subunit [Escherichia coli DEC13C] formate dehydrogenase, alpha subunit [Escherichia coli DEC13B] formate dehydrogenase, alpha subunit [Escherichia coli DEC13D] formate dehydrogenase, alpha subunit [Escherichia coli DEC13E] formate dehydrogenase, alpha subunit [Escherichia coli DEC14A] formate dehydrogenase, alpha subunit [Escherichia coli DEC14B] formate dehydrogenase, alpha subunit [Escherichia coli DEC14C] formate dehydrogenase, alpha subunit [Escherichia coli DEC14D] formate dehydrogenase, alpha subunit [Escherichia coli DEC15A] formate dehydrogenase, alpha subunit [Escherichia coli DEC15B] formate dehydrogenase, alpha subunit [Escherichia coli DEC15C] formate dehydrogenase, alpha subunit [Escherichia coli DEC15D] formate dehydrogenase, alpha subunit [Escherichia coli DEC15E] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli SCI-07] formate dehydrogenase, alpha subunit [Escherichia coli W26] formate dehydrogenase, alpha subunit [Escherichia coli J53] formate dehydrogenase, alpha subunit [Escherichia coli AI27] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O32:H37 str. P4] formate dehydrogenase H [Escherichia coli M919] formate dehydrogenase H [Escherichia coli H730] formate dehydrogenase H [Escherichia coli B799] formate dehydrogenase, alpha subunit [Escherichia coli 97.0246] formate dehydrogenase, alpha subunit [Escherichia coli 5.0588] formate dehydrogenase, alpha subunit [Escherichia coli 1.2264] formate dehydrogenase, alpha subunit [Escherichia coli 96.0497] formate dehydrogenase, alpha subunit [Escherichia coli 99.0741] formate dehydrogenase, alpha subunit [Escherichia coli 3.2608] formate dehydrogenase, alpha subunit [Escherichia coli 93.0624] formate dehydrogenase, alpha subunit [Escherichia coli 96.154] formate dehydrogenase, alpha subunit [Escherichia coli 5.0959] formate dehydrogenase, alpha subunit [Escherichia coli 9.0111] formate dehydrogenase, alpha subunit [Escherichia coli 4.0967] formate dehydrogenase, alpha subunit [Escherichia coli 2.3916] formate dehydrogenase, alpha subunit [Escherichia coli 3.3884] formate dehydrogenase, alpha subunit [Escherichia coli 2.4168] formate dehydrogenase, alpha subunit [Escherichia coli 3.2303] formate dehydrogenase, alpha subunit [Escherichia coli B41] formate dehydrogenase, alpha subunit [Escherichia coli 900105 (10e)] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O103:H2 str. CVM9450] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O111:H11 str. CVM9534] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O111:H11 str. CVM9545] formate dehydrogenase subunit alpha [Escherichia coli O26:H11 str. CVM10026] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O26:H11 str. CVM9942] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli 541-15] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli 541-1] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli 75] formate dehydrogenase, alpha subunit [Escherichia coli TW06591] formate dehydrogenase, alpha subunit [Shigella sonnei 3226-85] formate dehydrogenase, alpha subunit [Shigella sonnei 4822-66] formate dehydrogenase, alpha subunit [Escherichia coli EPECa12] formate dehydrogenase, alpha subunit [Escherichia coli EPEC C342-62] formate dehydrogenase-H subunit alpha [Escherichia coli O26:H11 str. CVM10224] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O111:H11 str. CVM9553] hypothetical protein ECO10021_28275 [Escherichia coli O26:H11 str. CVM10021] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O26:H11 str. CVM10030] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O111:H11 str. CVM9455] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O26:H11 str. CVM9952] formate dehydrogenase, alpha subunit [Escherichia coli STEC_O31] formate dehydrogenase H [Escherichia sp. 1_1_43] formate dehydrogenase, alpha subunit [Escherichia coli 5905] formate dehydrogenase, alpha subunit [Escherichia coli EC96038] formate dehydrogenase, alpha subunit [Escherichia coli 5412] formate dehydrogenase, alpha subunit [Escherichia coli TW15901] formate dehydrogenase, alpha subunit [Escherichia coli TW00353] formate dehydrogenase, alpha subunit [Escherichia coli 3006] formate dehydrogenase, alpha subunit [Escherichia coli N1] formate dehydrogenase, alpha subunit [Escherichia coli EC1865] formate dehydrogenase, alpha subunit [Escherichia coli 0.1288] formate dehydrogenase, alpha subunit [Escherichia coli AD30] formate dehydrogenase, alpha subunit [Escherichia coli 8.0566] formate dehydrogenase, alpha subunit [Escherichia coli 8.0569] formate dehydrogenase, alpha subunit [Escherichia coli 10.0869] formate dehydrogenase-H subunit alpha [Escherichia coli O26:H11 str. CFSAN001629] formate dehydrogenase-H subunit alpha [Escherichia coli O111:H11 str. CFSAN001630] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-02030] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-02033-1] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-02092] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-02093] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-02281] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-02318] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-02913] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-03439] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-03943] formate dehydrogenase H [Escherichia coli O104:H4 str. 11-04080] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-9990] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-9450] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-4984] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-4986] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-4987] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-4988] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-5603] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-5604] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec12-0465] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-6006] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec12-0466] formate dehydrogenase H [Escherichia coli O104:H4 str. Ec11-9941] formate dehydrogenase H [Escherichia coli KTE10] formate dehydrogenase H [Escherichia coli KTE12] formate dehydrogenase H [Escherichia coli KTE44] formate dehydrogenase H [Escherichia coli KTE193] formate dehydrogenase H [Escherichia coli KTE210] formate dehydrogenase H [Escherichia coli KTE212] formate dehydrogenase H [Escherichia coli KTE233] formate dehydrogenase H [Escherichia coli KTE234] formate dehydrogenase H [Escherichia coli KTE236] formate dehydrogenase H [Escherichia coli KTE237] formate dehydrogenase H [Escherichia coli KTE51] formate dehydrogenase H [Escherichia coli KTE56] formate dehydrogenase H [Escherichia coli KTE76] formate dehydrogenase H [Escherichia coli KTE77] formate dehydrogenase H [Escherichia coli KTE81] formate dehydrogenase H [Escherichia coli KTE111] formate dehydrogenase H [Escherichia coli KTE142] formate dehydrogenase H [Escherichia coli KTE119] formate dehydrogenase H [Escherichia coli KTE156] formate dehydrogenase H [Escherichia coli KTE161] formate dehydrogenase H [Escherichia coli KTE171] formate dehydrogenase H [Escherichia coli KTE9] formate dehydrogenase H [Escherichia coli KTE42] formate dehydrogenase H [Escherichia coli KTE29] formate dehydrogenase H [Escherichia coli KTE48] formate dehydrogenase H [Escherichia coli KTE50] formate dehydrogenase H [Escherichia coli KTE78] formate dehydrogenase H [Escherichia coli KTE79] formate dehydrogenase H [Escherichia coli KTE91] formate dehydrogenase H [Escherichia coli KTE101] formate dehydrogenase H [Escherichia coli KTE115] formate dehydrogenase H [Escherichia coli KTE135] formate dehydrogenase H [Escherichia coli KTE136] formate dehydrogenase H [Escherichia coli KTE144] formate dehydrogenase H [Escherichia coli KTE146] formate dehydrogenase H [Escherichia coli KTE154] formate dehydrogenase H [Escherichia coli KTE184] formate dehydrogenase H [Escherichia coli KTE196] formate dehydrogenase H [Escherichia coli KTE203] formate dehydrogenase H [Escherichia coli KTE197] formate dehydrogenase H [Escherichia coli KTE202] formate dehydrogenase H [Escherichia coli KTE112] formate dehydrogenase H [Escherichia coli KTE117] formate dehydrogenase H [Escherichia coli KTE120] formate dehydrogenase H [Escherichia coli KTE125] formate dehydrogenase H [Escherichia coli KTE138] formate dehydrogenase H [Escherichia coli KTE163] formate dehydrogenase H [Escherichia coli KTE166] formate dehydrogenase H [Escherichia coli KTE232] formate dehydrogenase H [Escherichia coli KTE90] formate dehydrogenase, alpha subunit [Escherichia coli PA48] formate dehydrogenase-H subunit alpha [Escherichia coli O08] selenoprotein anaerobic dehydrogenase, selenopolypeptide subunit C-terminus [Escherichia coli ONT:H33 str. C48/93] selenoprotein anaerobic dehydrogenase, selenopolypeptide subunit C-terminus [Escherichia coli O104:H4 str. E92/11] selenoprotein anaerobic dehydrogenase, selenopolypeptide subunit C-terminus [Escherichia coli O104:H4 str. E112/10] selenoprotein anaerobic dehydrogenase, selenopolypeptide subunit C-terminus [Escherichia coli O127:H27 str. C43/90] formate dehydrogenase, alpha subunit [Escherichia coli MP021552.11] formate dehydrogenase, alpha subunit [Escherichia coli MP021552.7] formate dehydrogenase, alpha subunit [Escherichia coli MP021552.12] formate dehydrogenase, alpha subunit [Escherichia coli MP021017.9] formate dehydrogenase, alpha subunit [Escherichia coli MP021017.6] formate dehydrogenase, alpha subunit [Escherichia coli MP021017.4] formate dehydrogenase, alpha subunit [Escherichia coli MP021017.10] formate dehydrogenase, alpha subunit [Escherichia coli MP021017.11] formate dehydrogenase, alpha subunit [Escherichia coli MP021017.12] formate dehydrogenase, alpha subunit [Escherichia coli C-34666] formate dehydrogenase, alpha subunit [Escherichia coli BCE034_MS-14] formate dehydrogenase, alpha subunit [Escherichia coli BCE002_MS12] formate dehydrogenase, alpha subunit [Escherichia coli 2872800] formate dehydrogenase, alpha subunit [Escherichia coli 2867750] formate dehydrogenase, alpha subunit [Escherichia coli 2866550] formate dehydrogenase, alpha subunit [Escherichia coli 2866450] formate dehydrogenase, alpha subunit [Escherichia coli 2866750] formate dehydrogenase, alpha subunit [Escherichia coli 2861200] formate dehydrogenase, alpha subunit [Escherichia coli 2860050] formate dehydrogenase, alpha subunit [Escherichia coli 2853500] formate dehydrogenase, alpha subunit [Escherichia coli 2850750] formate dehydrogenase, alpha subunit [Escherichia coli 2850400] formate dehydrogenase, alpha subunit [Escherichia coli 2845650] formate dehydrogenase, alpha subunit [Escherichia coli 2848050] formate dehydrogenase, alpha subunit [Escherichia coli 2785200] formate dehydrogenase, alpha subunit [Escherichia coli 2788150] formate dehydrogenase, alpha subunit [Escherichia coli 2780750] formate dehydrogenase, alpha subunit [Escherichia coli 2770900] formate dehydrogenase, alpha subunit [Escherichia coli 2762100] formate dehydrogenase, alpha subunit [Escherichia coli 2756500] formate dehydrogenase, alpha subunit [Escherichia coli 174750] formate dehydrogenase, alpha subunit [Escherichia coli ThroopD] formate dehydrogenase, alpha subunit [Escherichia coli P0302308.1] formate dehydrogenase, alpha subunit [Escherichia coli P0302293.2] formate dehydrogenase, alpha subunit [Escherichia coli MP021561.2] formate dehydrogenase, alpha subunit [Escherichia coli MP021552.8] formate dehydrogenase, alpha subunit [Escherichia coli MP021017.1] formate dehydrogenase, alpha subunit [Escherichia coli Jurua 20/10] formate dehydrogenase, alpha subunit [Escherichia coli MP020940.1] formate dehydrogenase, alpha subunit [Escherichia coli MP020980.2] formate dehydrogenase, alpha subunit [Escherichia coli Jurua 18/11] formate dehydrogenase, alpha subunit [Escherichia coli Envira 10/1] formate dehydrogenase, alpha subunit [Escherichia coli Envira 8/11] formate dehydrogenase, alpha subunit [Escherichia coli 2726800] formate dehydrogenase, alpha subunit [Escherichia coli BCE001_MS16] formate dehydrogenase, alpha subunit [Escherichia coli 2720900] formate dehydrogenase, alpha subunit [Escherichia coli 174900] formate dehydrogenase, alpha subunit [Escherichia coli 2722950] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.1] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.1] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.1] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.2] formate dehydrogenase, alpha subunit [Escherichia coli P0299917.1] formate dehydrogenase, alpha subunit [Escherichia coli BCE008_MS-13] formate dehydrogenase, alpha subunit [Escherichia coli 201600.1] formate dehydrogenase, alpha subunit [Escherichia coli 2726950] formate dehydrogenase, alpha subunit [Escherichia coli 179550] formate dehydrogenase, alpha subunit [Escherichia coli 180200] formate dehydrogenase, alpha subunit [Escherichia coli 2860650] formate dehydrogenase, alpha subunit [Escherichia coli 2864350] formate dehydrogenase, alpha subunit [Escherichia coli 2866350] formate dehydrogenase, alpha subunit [Escherichia coli BCE008_MS-01] formate dehydrogenase, alpha subunit [Escherichia coli BCE011_MS-01] formate dehydrogenase, alpha subunit [Escherichia coli MP021561.3] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.10] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.11] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.3] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.4] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.5] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.7] formate dehydrogenase, alpha subunit [Escherichia coli P02997067.6] formate dehydrogenase, alpha subunit [Escherichia coli P0299438.9] formate dehydrogenase, alpha subunit [Escherichia coli P0299917.2] formate dehydrogenase, alpha subunit [Escherichia coli P0299917.3] formate dehydrogenase, alpha subunit [Escherichia coli P0299917.4] formate dehydrogenase, alpha subunit [Escherichia coli P0299917.7] formate dehydrogenase, alpha subunit [Escherichia coli P0299917.9] formate dehydrogenase, alpha subunit [Escherichia coli P0302308.10] formate dehydrogenase, alpha subunit [Escherichia coli P0302308.4] formate dehydrogenase, alpha subunit [Escherichia coli P0302308.5] formate dehydrogenase, alpha subunit [Escherichia coli 179100] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.13] formate dehydrogenase, alpha subunit [Escherichia coli 2854350] formate dehydrogenase, alpha subunit [Escherichia coli MP020980.1] formate dehydrogenase, alpha subunit [Escherichia coli P0299483.1] formate dehydrogenase, alpha subunit [Escherichia coli P0299483.2] formate dehydrogenase, alpha subunit [Escherichia coli P0299483.3] formate dehydrogenase, alpha subunit [Escherichia coli P0302293.7] formate dehydrogenase, alpha subunit [Escherichia coli P0304799.3] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.14] formate dehydrogenase, alpha subunit [Escherichia coli P0302293.6] formate dehydrogenase, alpha subunit [Escherichia coli P0302293.8] formate dehydrogenase, alpha subunit [Escherichia coli P0302293.9] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.10] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.12] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.14] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.13] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.15] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.2] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.7] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.8] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.12] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.13] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.15] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.3] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.4] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.6] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.7] formate dehydrogenase, alpha subunit [Escherichia coli P0305260.8] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.11] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.12] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.8] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.9] formate dehydrogenase, alpha subunit [Escherichia coli 178200] formate dehydrogenase, alpha subunit [Escherichia coli 178850] formate dehydrogenase, alpha subunit [Escherichia coli P0302308.13] formate dehydrogenase, alpha subunit [Escherichia coli P0304816.5] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.7] formate dehydrogenase, alpha subunit [Escherichia coli p0305293.6] formate dehydrogenase-H subunit alpha [Escherichia coli O157:H43 str. T22] formate dehydrogenase H [Escherichia coli KTE13] formate dehydrogenase H [Escherichia coli KTE14] formate dehydrogenase H [Escherichia coli KTE35] formate dehydrogenase H [Escherichia coli KTE19] formate dehydrogenase H [Escherichia coli KTE34] formate dehydrogenase H [Escherichia coli KTE40] formate dehydrogenase H [Escherichia coli KTE199] formate dehydrogenase H [Escherichia coli KTE221] formate dehydrogenase H [Escherichia coli KTE198] formate dehydrogenase H [Escherichia coli KTE222] formate dehydrogenase H [Escherichia coli KTE61] formate dehydrogenase H [Escherichia coli KTE64] formate dehydrogenase H [Escherichia coli KTE73] formate dehydrogenase H [Escherichia coli KTE71] formate dehydrogenase H [Escherichia coli KTE100] formate dehydrogenase H [Escherichia coli KTE103] formate dehydrogenase H [Escherichia coli KTE108] formate dehydrogenase H [Escherichia coli KTE121] formate dehydrogenase H [Escherichia coli KTE132] formate dehydrogenase H [Escherichia coli KTE130] formate dehydrogenase H [Escherichia coli KTE155] formate dehydrogenase H [Escherichia coli KTE41] formate dehydrogenase H [Escherichia coli HVH 6 (3-8296502)] formate dehydrogenase H [Escherichia coli HVH 18 (4-8589585)] formate dehydrogenase H [Escherichia coli HVH 33 (4-2174936)] formate dehydrogenase H [Escherichia coli HVH 41 (4-2677849)] formate dehydrogenase H [Escherichia coli HVH 43 (4-2173468)] formate dehydrogenase H [Escherichia coli HVH 44 (4-2298570)] formate dehydrogenase H [Escherichia coli HVH 53 (4-0631051)] formate dehydrogenase H [Escherichia coli HVH 82 (4-2209276)] formate dehydrogenase H [Escherichia coli HVH 91 (4-4638751)] formate dehydrogenase H [Escherichia coli HVH 115 (4-4465997)] formate dehydrogenase H [Escherichia coli HVH 115 (4-4465989)] formate dehydrogenase H [Escherichia coli HVH 121 (4-6877826)] formate dehydrogenase H [Escherichia coli HVH 139 (4-3192644)] formate dehydrogenase H [Escherichia coli HVH 147 (4-5893887)] formate dehydrogenase H [Escherichia coli HVH 150 (4-3258106)] formate dehydrogenase H [Escherichia coli HVH 164 (4-5953081)] formate dehydrogenase H [Escherichia coli HVH 182 (4-0985554)] formate dehydrogenase H [Escherichia coli HVH 187 (4-4471660)] formate dehydrogenase H [Escherichia coli HVH 195 (3-7155360)] formate dehydrogenase H [Escherichia coli HVH 198 (4-3206106)] formate dehydrogenase H [Escherichia coli HVH 200 (4-4449924)] formate dehydrogenase H [Escherichia coli HVH 209 (4-3062651)] formate dehydrogenase H [Escherichia coli KOEGE 40 (102a)] formate dehydrogenase H [Escherichia coli KOEGE 33 (68a)] formate dehydrogenase H [Escherichia coli KOEGE 118 (317a)] formate dehydrogenase H [Escherichia coli KOEGE 131 (358a)] formate dehydrogenase H [Escherichia coli UMEA 3033-1] formate dehydrogenase H [Escherichia coli UMEA 3052-1] formate dehydrogenase H [Escherichia coli UMEA 3065-1] formate dehydrogenase H [Escherichia coli UMEA 3124-1] formate dehydrogenase H [Escherichia coli UMEA 3139-1] formate dehydrogenase H [Escherichia coli UMEA 3163-1] formate dehydrogenase H [Escherichia coli UMEA 3174-1] formate dehydrogenase H [Escherichia coli UMEA 3176-1] formate dehydrogenase H [Escherichia coli UMEA 3180-1] formate dehydrogenase H [Escherichia coli UMEA 3199-1] formate dehydrogenase H [Escherichia coli UMEA 3200-1] formate dehydrogenase H [Escherichia coli UMEA 3201-1] formate dehydrogenase H [Escherichia coli UMEA 3240-1] formate dehydrogenase H [Escherichia coli UMEA 3317-1] formate dehydrogenase H [Escherichia coli UMEA 3314-1] formate dehydrogenase H [Escherichia coli UMEA 3329-1] formate dehydrogenase H [Escherichia coli UMEA 3318-1] formate dehydrogenase H [Escherichia coli UMEA 3355-1] formate dehydrogenase H [Escherichia coli UMEA 3592-1] formate dehydrogenase H [Escherichia coli UMEA 3609-1] formate dehydrogenase H [Escherichia coli UMEA 3671-1] formate dehydrogenase H [Escherichia coli UMEA 3682-1] formate dehydrogenase H [Escherichia coli UMEA 3718-1] formate dehydrogenase H [Escherichia coli UMEA 3805-1] formate dehydrogenase H [Escherichia coli UMEA 3889-1] formate dehydrogenase H [Escherichia coli UMEA 3899-1] formate dehydrogenase H [Escherichia coli KOEGE 3 (4a)] formate dehydrogenase H [Escherichia coli KOEGE 7 (16a)] formate dehydrogenase H [Escherichia coli UMEA 3144-1] formate dehydrogenase H [Escherichia coli UMEA 3150-1] formate dehydrogenase H [Escherichia coli UMEA 3151-1] formate dehydrogenase H [Escherichia coli UMEA 3271-1] formate dehydrogenase H [Escherichia coli UMEA 3292-1] formate dehydrogenase, alpha subunit [Escherichia coli TW07509] formate dehydrogenase H [Escherichia coli BIDMC 19C] formate dehydrogenase, alpha subunit [Escherichia coli 113290] formate dehydrogenase, alpha subunit [Escherichia coli 113303] formate dehydrogenase, alpha subunit [Escherichia coli 907357] formate dehydrogenase, alpha subunit [Escherichia coli 909945-2] formate dehydrogenase, alpha subunit [Escherichia coli 113302] formate dehydrogenase, alpha subunit [Escherichia coli 907672] formate dehydrogenase, alpha subunit [Escherichia coli 907710] formate dehydrogenase, alpha subunit [Escherichia coli 908555] formate dehydrogenase, alpha subunit [Escherichia coli 908541] formate dehydrogenase, alpha subunit [Escherichia coli 908525] formate dehydrogenase, alpha subunit [Escherichia coli 908658] formate dehydrogenase H [Escherichia coli HVH 50 (4-2593475)] formate dehydrogenase H [Escherichia coli HVH 98 (4-5799287)] formate dehydrogenase H [Escherichia coli UMEA 3336-1] formate dehydrogenase H [Escherichia coli BIDMC 39] formate dehydrogenase H [Escherichia coli BIDMC 37] formate dehydrogenase H [Escherichia coli BWH 32] formate dehydrogenase H [Escherichia coli HVH 36 (4-5675286)] formate dehydrogenase H [Escherichia coli HVH 136 (4-5970458)] formate dehydrogenase H [Escherichia coli HVH 152 (4-3447545)] formate dehydrogenase H [Escherichia coli UMEA 3148-1] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli ECC-Z] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli P4-NR] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli P4-96] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli ECA-727] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli ECA-0157] formate dehydrogenase subunit alpha [Escherichia coli ATCC BAA-2215] formate dehydrogenase H [Escherichia coli UMEA 3489-1] formate dehydrogenase subunit alpha [Escherichia coli ATCC BAA-2196] formate dehydrogenase subunit alpha [Escherichia coli ATCC BAA-2219] formate dehydrogenase subunit alpha [Escherichia coli ATCC BAA-2193] formate dehydrogenase subunit alpha [Escherichia coli ATCC 35150] formate dehydrogenase H [Escherichia coli BIDMC 43b] formate dehydrogenase H [Escherichia coli BIDMC 43a] formate dehydrogenase H [Escherichia coli BIDMC 19B] formate dehydrogenase H [Escherichia coli BIDMC 19A] formate dehydrogenase H [Escherichia coli BIDMC 17A] formate dehydrogenase H [Escherichia coli BIDMC 17B] formate dehydrogenase H [Escherichia coli BIDMC 15] formate dehydrogenase H [Escherichia coli BIDMC 9] formate dehydrogenase H [Escherichia coli BIDMC 3] formate dehydrogenase H [Escherichia coli BIDMC 2B] formate dehydrogenase H [Escherichia coli BIDMC 6] formate dehydrogenase, alpha subunit [Escherichia coli 1-176-05_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-110-08_S1_C2] formate dehydrogenase [Escherichia coli O121:H19 str. 2010C-4254] formate dehydrogenase [Escherichia coli O26:NM str. 2010C-4347] formate dehydrogenase [Escherichia coli O45:H2 str. 2010C-3876] formate dehydrogenase [Escherichia coli O121:H19 str. 2010C-3840] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3526] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3521] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3517] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3518] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3516] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3510] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3511] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3509] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3507] formate dehydrogenase [Escherichia coli O103:H11 str. 2010C-3214] formate dehydrogenase [Escherichia coli O121:H19 str. 2009EL1412] formate dehydrogenase [Escherichia coli O121:H19 str. 2009C-4659] formate dehydrogenase [Escherichia coli O145:NM str. 08-4270] formate dehydrogenase [Escherichia coli O118:H16 str. 08-3651] formate dehydrogenase [Escherichia coli O69:H11 str. 07-4281] formate dehydrogenase [Escherichia coli O104:H4 str. 2011EL-1675A] formate dehydrogenase [Escherichia coli O103:H2 str. 2011C-3750] formate dehydrogenase [Escherichia coli O121:H19 str. 2011C-3537] formate dehydrogenase [Escherichia coli O121:H19 str. 2011C-3216] formate dehydrogenase [Escherichia coli O121:H19 str. 2011C-3108] formate dehydrogenase [Escherichia coli O121:H19 str. 2011C-3072] formate dehydrogenase [Escherichia coli O121:H19 str. 2010EL1058] formate dehydrogenase [Escherichia coli O121:H19 str. 2010C-4989] formate dehydrogenase [Escherichia coli O153:H2 str. 2010C-5034] formate dehydrogenase [Escherichia coli O157:H7 str. 2010C-4979C1] formate dehydrogenase [Escherichia coli O121:H19 str. 2010C-4966] formate dehydrogenase [Escherichia coli O165:H25 str. 2010C-4874] formate dehydrogenase [Escherichia coli O121:H19 str. 2010C-4824] formate dehydrogenase [Escherichia coli O26:NM str. 2010C-4788] formate dehydrogenase [Escherichia coli O121:H19 str. 2010C-4732] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-4557C2] formate dehydrogenase [Escherichia coli O103:H2 str. 2010C-4433] formate dehydrogenase [Escherichia coli O91:H14 str. 06-3691] formate dehydrogenase [Escherichia coli O55:H7 str. 06-3555] formate dehydrogenase [Escherichia coli O118:H16 str. 06-3612] formate dehydrogenase [Escherichia coli O145:NM str. 06-3484] formate dehydrogenase [Escherichia coli O69:H11 str. 06-3325] formate dehydrogenase [Escherichia coli O121:H19 str. 06-3003] formate dehydrogenase [Escherichia coli O118:H16 str. 06-3256] formate dehydrogenase [Escherichia coli O174:H21 str. 03-3269] formate dehydrogenase [Escherichia coli O121:H19 str. 03-3227] formate dehydrogenase [Escherichia coli O113:H21 str. 07-4224] formate dehydrogenase [Escherichia coli O28ac:NM str. 02-3404] formate dehydrogenase [Escherichia coli O45:H2 str. 01-3147] formate dehydrogenase [Escherichia coli O174:H8 str. 04-3038] formate dehydrogenase [Escherichia coli O103:H11 str. 04-3023] formate dehydrogenase [Escherichia coli O26:H11 str. 05-3646] formate dehydrogenase [Escherichia coli O104:H21 str. 94-3025] formate dehydrogenase [Escherichia coli O157:H16 str. 98-3133] formate dehydrogenase [Escherichia coli O25:NM str. E2539C1] formate dehydrogenase [Escherichia coli O121:H19 str. F6714] formate dehydrogenase [Escherichia coli O169:H41 str. F9792] formate dehydrogenase [Escherichia coli O15:H18 str. K1516] formate dehydrogenase [Escherichia coli O121:H19 str. K5198] formate dehydrogenase [Escherichia coli O121:H19 str. K5269] formate dehydrogenase [Escherichia coli O91:H14 str. 2009C-3227] formate dehydrogenase [Escherichia coli O145:H28 str. 2009C-3292] formate dehydrogenase [Escherichia coli O103:H2 str. 2009C-3279] formate dehydrogenase [Escherichia coli O69:H11 str. 08-4661] formate dehydrogenase [Escherichia coli O121:H7 str. 2009C-3299] formate dehydrogenase [Escherichia coli O45:H2 str. 2009C-3686] formate dehydrogenase [Escherichia coli O69:H11 str. 2009C-3601] formate dehydrogenase [Escherichia coli O123:H11 str. 2009C-3307] formate dehydrogenase [Escherichia coli O91:NM str. 2009C-3745] formate dehydrogenase [Escherichia coli O121:H19 str. 2009C-4050] formate dehydrogenase [Escherichia coli O118:H16 str. 2009C-4446] formate dehydrogenase [Escherichia coli O91:H21 str. 2009C-4646] formate dehydrogenase [Escherichia coli O45:H2 str. 2009C-4780] formate dehydrogenase [Escherichia coli O121:H19 str. 2009C-4750] formate dehydrogenase [Escherichia coli O121:H19 str. 2009EL1302] formate dehydrogenase [Escherichia coli O145:NM str. 2010C-3508] formate dehydrogenase [Escherichia coli E1728] formate dehydrogenase [Escherichia coli O26:H11 str. 06-3464] formate dehydrogenase [Escherichia coli O26:H11 str. 03-3500] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-4430] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-4819] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-4834] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-5028] formate dehydrogenase [Escherichia coli O26:H11 str. 2010EL-1699] formate dehydrogenase [Escherichia coli O26:H11 str. 2011C-3270] formate dehydrogenase [Escherichia coli O26:H11 str. 2011C-3506] formate dehydrogenase [Escherichia coli O26:H11 str. 2011C-3387] formate dehydrogenase [Escherichia coli O26:H11 str. 2011C-3282] formate dehydrogenase [Escherichia coli O26:H11 str. 2011C-3655] formate dehydrogenase [Escherichia coli O26:H11 str. 2009C-3689] formate dehydrogenase [Escherichia coli O26:H11 str. 2009C-3612] formate dehydrogenase [Escherichia coli O26:H11 str. 2009C-3996] formate dehydrogenase [Escherichia coli O26:H11 str. 2009C-4760] formate dehydrogenase [Escherichia coli O26:H11 str. 2009C-4826] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-3051] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-3472] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-3871] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-3902] formate dehydrogenase [Escherichia coli O26:H11 str. 2010C-4244] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-176-05_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-392-07_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-176-05_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-250-04_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-250-04_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-176-05_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-005-03_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-176-05_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-011-08_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-005-03_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-005-03_S1_C1] formate dehydrogenase [Escherichia coli O26:H1 str. 2009C-4747] formate dehydrogenase H [Escherichia coli BIDMC 82] formate dehydrogenase, alpha subunit [Escherichia coli 2-011-08_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-052-05_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-182-04_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-011-08_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-176-05_S4_C2] formate dehydrogenase H [Escherichia coli BIDMC 59] formate dehydrogenase H [Escherichia coli BIDMC 71] formate dehydrogenase H [Escherichia coli BIDMC 74] formate dehydrogenase H [Escherichia coli CHS 77] formate dehydrogenase H [Escherichia coli MGH 57] formate dehydrogenase H [Escherichia coli UCI 53] formate dehydrogenase H [Escherichia coli UCI 57] formate dehydrogenase H [Escherichia coli UCI 58] formate dehydrogenase H [Escherichia coli UCI 65] formate dehydrogenase H [Escherichia coli UCI 66] formate dehydrogenase [Escherichia coli O145:H28 str. 4865/96] formate dehydrogenase, alpha subunit [Escherichia coli 2-011-08_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-011-08_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-011-08_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-052-05_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-011-08_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 3-105-05_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 3-267-03_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-373-03_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-373-03_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 3-373-03_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-475-03_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-475-03_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-105-05_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-267-03_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-267-03_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-373-03_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-267-03_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-373-03_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 3-073-06_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-373-03_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S4_C3] formate dehydrogenase [Escherichia coli O78:H12 str. 00-3279] formate dehydrogenase [Escherichia coli O145:H25 str. 07-3858] formate dehydrogenase [Escherichia coli O69:H11 str. 07-3763] formate dehydrogenase [Escherichia coli O146:H21 str. 2010C-3325] formate dehydrogenase [Escherichia coli O91:H21 str. 2009C-3740] formate dehydrogenase [Escherichia coli O121:H19 str. 2011C-3609] formate dehydrogenase [Escherichia coli O45:H2 str. 2010C-4211] formate dehydrogenase [Escherichia coli O128:H2 str. 2011C-3317] formate dehydrogenase [Escherichia coli O26:H11 str. 2011C-3274] formate dehydrogenase [Escherichia coli O118:H16 str. 07-4255] formate dehydrogenase, alpha subunit [Escherichia coli 2-052-05_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-052-05_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-156-04_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-156-04_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-156-04_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-177-06_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-177-06_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-156-04_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-156-04_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-177-06_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-177-06_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-177-06_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-210-07_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-005-03_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-005-03_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 1-392-07_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-005-03_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-392-07_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-210-07_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-210-07_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-177-06_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-210-07_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-156-04_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-250-04_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-250-04_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-156-04_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-210-07_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-210-07_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-222-05_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-210-07_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-222-05_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-222-05_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-316-03_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-316-03_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-316-03_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-427-07_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-427-07_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-427-07_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-427-07_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-460-02_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-460-02_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-460-02_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-460-02_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 2-427-07_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 3-020-07_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-073-06_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-073-06_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-073-06_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-073-06_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-105-05_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-073-06_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-427-07_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 6-175-07_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-427-07_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-460-02_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-267-03_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-020-07_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-475-03_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 3-475-03_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 3-475-03_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 4-203-08_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 5-172-05_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 5-172-05_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 5-172-05_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 5-172-05_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 5-172-05_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 5-366-08_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 5-366-08_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 5-366-08_S3_C1] formate dehydrogenase, alpha subunit [Escherichia coli 6-175-07_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 6-175-07_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 6-319-05_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 6-319-05_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 6-319-05_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 6-175-07_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 6-175-07_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 6-319-05_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 7-233-03_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-222-05_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 6-537-08_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 7-233-03_S1_C3] formate dehydrogenase, alpha subunit [Escherichia coli 6-319-05_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 7-233-03_S3_C3] formate dehydrogenase, alpha subunit [Escherichia coli 7-233-03_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 7-233-03_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 8-415-05_S1_C1] formate dehydrogenase, alpha subunit [Escherichia coli 7-233-03_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 7-233-03_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 6-537-08_S4_C2] formate dehydrogenase, alpha subunit [Escherichia coli 1-392-07_S4_C3] formate dehydrogenase, alpha subunit [Escherichia coli 2-474-04_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-392-07_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 8-415-05_S1_C2] formate dehydrogenase, alpha subunit [Escherichia coli 5-366-08_S4_C1] formate dehydrogenase, alpha subunit [Escherichia coli 1-250-04_S3_C2] formate dehydrogenase, alpha subunit [Escherichia coli 2-460-02_S1_C1] formate dehydrogenase [Escherichia coli E1140] formate dehydrogenase-H subunit alpha [Escherichia coli NCTC 50110] formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli G3/10] formate dehydrogenase [Escherichia coli C691-71 (14b)] formate dehydrogenase, alpha subunit [Escherichia coli 97.0264] formate dehydrogenase [Escherichia coli M114] formate dehydrogenase-H subunit alpha [Escherichia coli VL2732] formate dehydrogenase-H subunit alpha [Escherichia coli K71] formate dehydrogenase-H subunit alpha [Escherichia coli VL2874] Formate dehydrogenase H [Escherichia coli PCN009] Formate dehydrogenase H [Escherichia coli PCN079] formate dehydrogenase subunit alpha [Escherichia coli O157:H43] formate dehydrogenase subunit alpha [Escherichia coli N37058PS] formate dehydrogenase subunit alpha [Escherichia coli N37122PS] formate dehydrogenase subunit alpha [Escherichia coli N40607] formate dehydrogenase subunit alpha [Escherichia coli N36254PS] formate dehydrogenase [Escherichia coli N37139PS] formate dehydrogenase subunit alpha [Escherichia coli N36410PS] formate dehydrogenase-H subunit alpha [Escherichia coli SHECO001] formate dehydrogenase, alpha subunit [Escherichia coli M056] formate dehydrogenase, alpha subunit [Escherichia coli TA144] formate dehydrogenase, alpha subunit [Escherichia coli TA447] formate dehydrogenase, alpha subunit [Escherichia coli H386] formate dehydrogenase, alpha subunit [Escherichia coli TA255] formate dehydrogenase, alpha subunit [Escherichia coli H617] formate dehydrogenase, alpha subunit [Escherichia coli H420] formate dehydrogenase, alpha subunit [Escherichia coli H454] formate dehydrogenase, alpha subunit [Escherichia coli TA008] formate dehydrogenase, alpha subunit [Escherichia coli TA054] formate dehydrogenase, alpha subunit [Escherichia coli T426] formate dehydrogenase, alpha subunit [Escherichia coli TA249] formate dehydrogenase, alpha subunit [Escherichia coli R424] formate dehydrogenase [Escherichia coli O55:H7 str. TB182A] Formate dehydrogenase H [Escherichia coli O10:K5(L):H4 str. ATCC 23506] Formate dehydrogenase H [Escherichia coli O5:K4(L):H4 str. ATCC 23502] Formate dehydrogenase H @ selenocysteine-containing [Escherichia coli IS1] Formate dehydrogenase H @ selenocysteine-containing [Escherichia coli IS5] Formate dehydrogenase H @ selenocysteine-containing [Escherichia coli IS9] Formate dehydrogenase H @ selenocysteine-containing [Escherichia coli IS25] Formate dehydrogenase H @ selenocysteine-containing [Escherichia coli ISC7] Formate dehydrogenase, alpha subunit [Escherichia coli D6-113.11] Putative uncharacterized protein [Escherichia coli D6-117.29] Formate dehydrogenase-H, selenopolypeptide subunit [Escherichia coli O26:H11] formate dehydrogenase-H [Klebsiella pneumoniae] truncated formate dehydrogenase H [Escherichia coli SE11] formate dehydrogenase [Escherichia coli O145:H28] |
0.0 | 100 | 100.000 | WP_000063439 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_077818427 |
formate dehydrogenase subunit alpha [Escherichia coli] formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 99.794 | WP_135564515 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | WP_139504242 |
formate dehydrogenase subunit alpha [Escherichia coli] |
0.0 | 100 | 100.000 | EAA2201947 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_9 In blautia CP039126.1
Seq (len = 168 ):
RCNRNRKNYGKGAIQRLGQSNGMDIKTISTGSLSIDTALGVGGIPQGRIIEIYGPESSGKTTVALHIITEIQRHGGVAAFIDAEHALDPAYAKNIGVDINYLYVSQPDDGEQALEITEVMVRSGSVDLIVIDSVAALVPKAEINGEIGDSHVGLQARLMSQALRKLTA
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|209025|1|5864154-5864658
Transkriptom
8.0% of gene length expressed over median expression of contig.
ŝ
6.966040409180544
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
recombinase RecA [Eubacterium oxidoreducens]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
recombinase RecA [Eubacterium oxidoreducens] recombination protein RecA [Eubacterium oxidoreducens] |
1.19e-86 | 96 | 77.301 | WP_090174839 |
recombinase RecA [Anaerosacchriphilus polymeriproducens] recombinase RecA [Anaerosacchriphilus polymeriproducens] |
2.58e-86 | 96 | 76.687 | WP_115480147 |
recombinase RecA, partial [Lachnotalea glycerini] |
3.13e-86 | 97 | 72.561 | OYP35257 |
recombinase RecA [Lachnospiraceae bacterium] recombination protein RecA [Lachnospiraceae bacterium] |
3.3e-86 | 96 | 77.301 | WP_079482753 |
recombinase RecA [Lachnospiraceae bacterium] recombinase RecA [Lachnospiraceae bacterium] |
3.33e-86 | 96 | 76.687 | HCA70012 |
recombinase RecA [Lachnospiraceae bacterium MC2017] |
3.92e-86 | 96 | 78.528 | WP_044907331 |
recombinase RecA [Robinsoniella peoriensis] Recombinase A [Robinsoniella peoriensis] |
4.1e-86 | 96 | 77.301 | WP_138002564 |
recombinase RecA [Lachnospiraceae bacterium] |
5.94e-86 | 96 | 76.687 | HCR41229 |
recombinase RecA [Lachnospiraceae bacterium NK4A144] |
7.78e-86 | 96 | 77.914 | WP_044982745 |
recombinase RecA [Robinsoniella sp. KNHs210] |
1.14e-85 | 97 | 76.220 | WP_044289456 |
recombinase RecA [Roseburia sp.] |
1.2e-85 | 96 | 76.074 | HCJ76626 |
recombinase RecA [Herbinix hemicellulosilytica] recombination protein RecA [Herbinix hemicellulosilytica] |
1.21e-85 | 96 | 76.074 | WP_125476212 |
recombinase RecA [Robinsoniella peoriensis] hypothetical protein RHS_0355 [Robinsoniella sp. RHS] |
1.41e-85 | 97 | 76.220 | WP_044297046 |
recombinase RecA [Lachnospiraceae bacterium AD3010] |
1.46e-85 | 96 | 78.528 | WP_035649120 |
recombinase RecA [Blautia sp. An249] recombinase RecA [Blautia sp. An249] |
1.47e-85 | 97 | 75.610 | WP_087218741 |
recombinase RecA [Ruminococcus gauvreauii] |
1.8e-85 | 96 | 75.460 | WP_044983107 |
protein RecA [Clostridium sp. CAG:299] |
2.33e-85 | 96 | 75.460 | CDD38694 |
MULTISPECIES: recombinase RecA [unclassified Roseburia] recombinase RecA [Roseburia sp. AF42-8] recombinase RecA [Roseburia sp. AF34-16] recombinase RecA [Roseburia sp. AF02-12] recombinase RecA [Roseburia sp. OM04-10BH] recombinase RecA [Roseburia sp. OM04-15AA] |
2.62e-85 | 96 | 75.460 | WP_117698724 |
recombinase RecA [Ruminococcaceae bacterium] |
2.68e-85 | 97 | 75.610 | WP_148462514 |
recombinase RecA [Ruminococcus sp. AM42-11] Recombinase A [[Ruminococcus] torques] Recombinase A [uncultured Blautia sp.] Recombinase A [uncultured Ruminococcus sp.] Recombinase A [uncultured Clostridium sp.] recombinase RecA [Ruminococcus sp. AM42-11] |
2.76e-85 | 97 | 75.610 | WP_118580990 |
recombinase RecA [Blautia sp. OM05-6] recombinase RecA [Blautia sp. OM05-6] |
2.91e-85 | 96 | 76.687 | WP_118699898 |
MULTISPECIES: recombinase RecA [unclassified Roseburia] protein RecA [Roseburia sp. CAG:45] Recombinase A [uncultured Roseburia sp.] recombinase RecA [Roseburia sp.] recombinase RecA [Roseburia sp. AF22-8AC] recombinase RecA [Roseburia sp. AF22-2LB] |
3.09e-85 | 96 | 75.460 | WP_022243249 |
recombinase RecA [Butyrivibrio sp. VCB2006] |
3.1e-85 | 96 | 77.301 | WP_029232711 |
recombinase RecA [Roseburia sp. AF20-18LB] recombinase RecA [Roseburia sp. AF20-18LB] |
3.23e-85 | 96 | 75.460 | WP_118173160 |
recombinase RecA [Lachnoclostridium sp.] |
3.52e-85 | 96 | 76.687 | HAE81233 |
MULTISPECIES: recombinase RecA [Lachnospiraceae] recombinase RecA [Blautia sp. CAG:37_48_57] protein RecA [Blautia sp. CAG:37] recombinase RecA [Lachnospiraceae bacterium] recombinase RecA [Blautia sp. AM23-13AC] recombinase RecA [Blautia sp. AF32-4BH] |
3.54e-85 | 96 | 76.687 | WP_022463338 |
protein RecA [Clostridium sp. CAG:411] |
4.17e-85 | 96 | 75.460 | CDE47482 |
recombinase RecA [Ruminococcus sp. AF41-9] recombinase RecA [Ruminococcus sp. AF41-9] |
4.63e-85 | 97 | 75.000 | WP_119233103 |
recombinase RecA [Anaerostipes sp. 992a] recombinase RecA [Anaerostipes sp. 992a] |
5.22e-85 | 96 | 75.460 | WP_075670268 |
recombinase RecA [Lachnospiraceae bacterium KH1T2] recombination protein RecA [Lachnospiraceae bacterium KH1T2] |
5.3e-85 | 96 | 76.687 | WP_089967935 |
recombinase RecA, partial [[Clostridium] cellulosi] |
5.53e-85 | 96 | 74.691 | PZM89593 |
recombinase RecA [Clostridiales bacterium CHKCI001] recombinase A [Clostridiales bacterium CHKCI001] |
5.56e-85 | 96 | 76.074 | WP_089822190 |
MULTISPECIES: recombinase RecA [Clostridiales] RecA protein [Clostridium sp. KLE 1755] recombinase RecA [Eisenbergiella tayi] recombinase RecA [Eisenbergiella massiliensis] recombinase RecA [Eisenbergiella massiliensis] |
5.78e-85 | 96 | 76.074 | WP_021636669 |
recombinase RecA [Lachnospiraceae bacterium ND2006] |
5.85e-85 | 96 | 76.687 | WP_035635917 |
recombinase RecA [Lachnospiraceae bacterium] |
5.96e-85 | 96 | 77.301 | HBH98653 |
recombinase RecA [Eubacterium sp.] recombinase RecA [Eubacterium sp.] recombinase RecA [Eubacterium sp.] |
6.35e-85 | 96 | 76.074 | HAR71432 |
MULTISPECIES: recombinase RecA [unclassified Ruminococcus] recombinase RecA [Ruminococcus sp. AF14-5] recombinase RecA [Ruminococcus sp. AM46-18] |
7.51e-85 | 97 | 75.000 | WP_118610836 |
recombinase RecA [Lachnospiraceae bacterium A4] protein recA [Lachnospiraceae bacterium A4] |
7.59e-85 | 96 | 76.687 | WP_016282038 |
recombinase RecA [Lachnospiraceae bacterium] |
7.6e-85 | 96 | 76.687 | HCM91995 |
recombinase RecA [Candidatus Galacturonibacter soehngenii] recombinase RecA [Candidatus Galacturonibacter soehngenii] |
7.65e-85 | 96 | 74.233 | WP_151141756 |
MULTISPECIES: recombinase RecA [unclassified Ruminococcus] recombinase RecA [Ruminococcus sp. TM10-9AT] recombinase RecA [Ruminococcus sp. AF13-37] recombinase RecA [Ruminococcus sp. AF13-28] recombinase RecA [Ruminococcus sp. AM58-7XD] recombinase RecA [Ruminococcus sp. AM30-15AC] |
7.7e-85 | 97 | 75.000 | WP_117677006 |
recombinase RecA [Lachnoclostridium sp. An14] recombinase RecA [Lachnoclostridium sp. An14] |
7.78e-85 | 96 | 75.460 | WP_087222527 |
protein RecA [Butyrivibrio sp. CAG:318] |
7.99e-85 | 96 | 74.847 | CDC39349 |
protein RecA [Firmicutes bacterium CAG:882] |
8.27e-85 | 96 | 76.074 | CDD65715 |
recombinase RecA [Acetitomaculum ruminis] recombination protein RecA [Acetitomaculum ruminis DSM 5522] |
8.73e-85 | 96 | 76.074 | WP_092874518 |
MULTISPECIES: recombinase RecA [Clostridiales] protein RecA [[Clostridium] cf. saccharolyticum K10] protein RecA [butyrate-producing bacterium SM4/1] RecA protein [Clostridium sp. M62/1] DNA recombination/repair protein RecA [[Clostridium] saccharolyticum] recombinase RecA [Clostridium sp. AM29-11AC] |
8.82e-85 | 96 | 75.460 | WP_008398996 |
recombinase RecA [Blautia wexlerae] |
9.04e-85 | 97 | 75.000 | WP_026648446 |
MULTISPECIES: recombinase RecA [Clostridiales] recombinase RecA [Ruminococcus sp. CAG:9-related_41_34] protein RecA [Ruminococcus sp. CAG:9] recombinase RecA [Ruminococcus sp. AM23-1LB] recombinase RecA [Ruminococcus sp. AM18-44] recombinase RecA [Ruminococcus sp. AM18-15] |
9.04e-85 | 97 | 75.000 | WP_022381059 |
recombinase RecA [Butyrivibrio sp. X503] recombinase RecA [Butyrivibrio sp. X503] |
9.04e-85 | 96 | 76.687 | WP_120656347 |
protein RecA [Clostridium sp. CAG:149] |
9.3e-85 | 96 | 75.460 | CCY85343 |
recombinase RecA [Butyrivibrio sp. INlla21] recombination protein RecA [Butyrivibrio sp. INlla21] |
9.34e-85 | 96 | 76.687 | WP_092243521 |
recombinase RecA [Ruminococcus sp. OM08-7] recombinase RecA [Ruminococcus sp. OM08-7] |
9.47e-85 | 97 | 75.000 | WP_118630562 |
recombinase RecA [Butyrivibrio sp. CB08] recombinase RecA [Butyrivibrio sp. CB08] |
1e-84 | 96 | 76.074 | WP_120742014 |
recombinase RecA [Ruminococcus sp. 5_1_39BFAA] protein recA [Ruminococcus sp. 5_1_39BFAA] |
1.01e-84 | 97 | 75.000 | WP_008704083 |
recombinase RecA [[Clostridium] polysaccharolyticum] recombination protein RecA [[Clostridium] polysaccharolyticum] |
1.03e-84 | 96 | 75.460 | WP_092476977 |
recombinase RecA [[Clostridium] aminophilum] recombination protein RecA [[Clostridium] aminophilum] |
1.03e-84 | 96 | 75.460 | WP_074649053 |
recombinase RecA [[Eubacterium] cellulosolvens] |
1.06e-84 | 96 | 75.460 | WP_034908282 |
recombinase RecA [Lachnospiraceae bacterium] |
1.07e-84 | 97 | 76.220 | HAD55075 |
recombinase RecA [Anaerocolumna aminovalerica] |
1.09e-84 | 96 | 74.847 | WP_091684269 |
recombinase RecA [bacterium 1XD21-70] recombinase RecA [bacterium 1XD21-70] |
1.1e-84 | 96 | 75.309 | WP_121706865 |
MULTISPECIES: recombinase RecA [unclassified Clostridium] protein RecA 1 [Clostridium sp. CAG:91] recombinase RecA [Lachnospiraceae bacterium] recombinase RecA [Clostridium sp. AF46-9NS] recombinase RecA [Clostridium sp. AF36-18BH] recombinase RecA [Clostridium sp. AF34-10BH] |
1.13e-84 | 97 | 76.220 | WP_022313233 |
MULTISPECIES: recombinase RecA [Clostridiales] recombinase RecA [Blautia luti DSM 14534] recombinase RecA [Ruminococcus sp. AF21-42] |
1.13e-84 | 97 | 74.390 | WP_118508403 |
recombination protein RecA [Anaerocolumna aminovalerica] |
1.15e-84 | 96 | 74.847 | SFN88171 |
MULTISPECIES: recombinase RecA [unclassified Firmicutes sensu stricto (miscellaneous)] recombinase RecA [Firmicutes bacterium CAG:65_45_313] protein RecA 1 [Firmicutes bacterium CAG:65] recombinase RecA [Lachnospiraceae bacterium] recombinase RecA [Firmicutes bacterium AM59-13] recombinase RecA [Firmicutes bacterium AF22-6AC] |
1.15e-84 | 96 | 76.687 | WP_022155189 |
MULTISPECIES: recombinase RecA [Clostridiales] recombinase RecA [Ruminococcus sp. TF11-2AC] Recombinase A [Blautia obeum] |
1.16e-84 | 97 | 75.000 | WP_055057378 |
recombinase RecA [Lachnospiraceae bacterium WCA3-601-WT-6H] recombinase RecA [Lachnospiraceae bacterium WCA3-601-WT-6H] |
1.18e-84 | 96 | 76.687 | WP_154495628 |
recombinase RecA [Butyrivibrio sp. XB500-5] recombinase RecA [Butyrivibrio sp. XB500-5] |
1.19e-84 | 96 | 76.687 | WP_120685367 |
recombinase RecA [Ruminococcaceae bacterium] |
1.22e-84 | 97 | 75.000 | WP_019162319 |
recombinase RecA [Ruminococcus sp. AF19-29] recombinase RecA [Ruminococcus sp. AF19-29] |
1.24e-84 | 97 | 75.000 | WP_118669941 |
Recombinase A [uncultured Clostridium sp.] recombinase RecA [Lachnospiraceae bacterium] recombinase RecA [Lachnospiraceae bacterium] |
1.26e-84 | 97 | 76.220 | SCH91347 |
recombinase RecA [[Clostridium] aldenense] recombinase RecA [[Clostridium] aldenense] |
1.29e-84 | 96 | 75.460 | WP_118705261 |
recombinase RecA [Clostridium sp. AF46-12NS] recombinase RecA [Clostridium sp. AF46-12NS] |
1.33e-84 | 97 | 76.220 | WP_117466306 |
MULTISPECIES: recombinase RecA [Clostridiales] recombinase RecA [Lachnoclostridium sp. SNUG30386] recombinase RecA [Clostridium sp. OM05-5BH] |
1.37e-84 | 96 | 75.460 | WP_107000342 |
recombinase RecA [Clostridium sp. AF24-2LB] recombinase RecA [Clostridium sp. AF24-2LB] |
1.4e-84 | 96 | 75.460 | WP_118556089 |
MULTISPECIES: recombinase RecA [unclassified Clostridium] protein RecA [Clostridium sp. CAG:43] recombinase RecA [Clostridium sp. AF12-41] recombinase RecA [Clostridium sp. AM18-55] recombinase RecA [Clostridium sp. AF50-3] recombinase RecA [Clostridium sp. AF37-7] |
1.4e-84 | 96 | 75.460 | WP_022359677 |
recombinase RecA [[Clostridium] aldenense] recombinase RecA [[Clostridium] aldenense] recombinase RecA [Dorea longicatena] |
1.51e-84 | 96 | 75.460 | WP_117556371 |
recombinase RecA [Firmicutes bacterium] |
1.54e-84 | 97 | 75.000 | WP_147578058 |
protein RecA 1 [Clostridium sp. CAG:510] |
1.58e-84 | 96 | 76.687 | CDA67897 |
recombinase RecA [[Clostridium] aminophilum] recombination protein RecA [[Clostridium] aminophilum] |
1.59e-84 | 96 | 75.460 | WP_031474637 |
protein RecA [Firmicutes bacterium CAG:424] |
1.61e-84 | 97 | 75.000 | CDC46540 |
recombinase RecA [Mobilisporobacter senegalensis] recombination protein RecA [Mobilisporobacter senegalensis] |
1.69e-84 | 96 | 74.233 | WP_123610798 |
recombinase RecA [Lachnospiraceae bacterium] |
1.7e-84 | 96 | 75.460 | HCI23793 |
Recombinase A [uncultured Clostridium sp.] |
1.71e-84 | 96 | 74.534 | SCJ57884 |
MULTISPECIES: recombinase RecA [Butyrivibrio] recombination protein RecA [Butyrivibrio sp. M55] |
1.78e-84 | 96 | 75.460 | WP_034461987 |
recombinase RecA [Anaerocolumna aminovalerica] |
1.84e-84 | 96 | 74.847 | WP_097015615 |
recombinase RecA [Firmicutes bacterium] Recombinase A [uncultured Clostridium sp.] |
1.88e-84 | 96 | 76.687 | WP_148448789 |
protein RecA [Clostridium sp. CAG:167] |
1.89e-84 | 96 | 74.074 | CCZ90667 |
recombinase RecA [Butyrivibrio sp. INlla18] recombination protein RecA [Butyrivibrio sp. INlla18] |
1.98e-84 | 96 | 76.074 | WP_091756666 |
recombinase RecA [Blautia sp. Marseille-P3201T] |
2.01e-84 | 97 | 74.390 | WP_072448952 |
recombinase RecA [Lachnospiraceae bacterium] |
2.03e-84 | 96 | 74.233 | HAV26919 |
recombinase RecA [Butyrivibrio sp. VCB2001] |
2.16e-84 | 96 | 75.460 | WP_026522020 |
recombinase RecA [Butyrivibrio hungatei] recombinase RecA [Butyrivibrio hungatei] recombination protein RecA [Butyrivibrio hungatei DSM 14810] |
2.2e-84 | 96 | 76.074 | WP_071176250 |
recombinase RecA [Butyrivibrio hungatei] recombination protein RecA [Butyrivibrio hungatei] |
2.21e-84 | 96 | 75.460 | WP_074462590 |
recombinase RecA [Butyrivibrio sp. YAB3001] recombination protein RecA [Butyrivibrio sp. YAB3001] |
2.24e-84 | 96 | 76.074 | WP_092326015 |
recombinase RecA [Butyrivibrio sp. XPD2006] |
2.29e-84 | 96 | 76.074 | WP_022765613 |
recombinase RecA [Butyrivibrio sp. NC2007] |
2.36e-84 | 96 | 75.460 | WP_022767021 |
recombinase RecA [[Clostridium] symbiosum] recA [ [[Clostridium] symbiosum WAL-14163] Recombinase A [uncultured Clostridium sp.] |
2.38e-84 | 96 | 74.233 | WP_003499014 |
recombinase RecA [Ruminococcus sp. 1xD21-23] recombinase RecA [Ruminococcus sp. 1xD21-23] |
2.38e-84 | 96 | 74.691 | WP_150835149 |
recombinase RecA [Ruminococcus sp. AF31-8BH] recombinase RecA [Ruminococcus sp. AF31-8BH] |
2.44e-84 | 96 | 74.847 | WP_117851587 |
protein RecA [Ruminococcus sp. CAG:60] Recombinase A [uncultured Blautia sp.] recombinase RecA [Blautia sp.] |
2.47e-84 | 96 | 74.847 | CCY32662 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_10 In blautia CP039126.1
Seq (len = 66 ):
IRAALCTDCFCAEATRQHNNANVLALGGRVVGPGLAVKIVDTFLHTEFSGAERHQRRIDLIEGDRT
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|240989|-1|5769964-5770300
Transkriptom
26.0% of gene length expressed over median expression of contig.
ŝ
6.639510660455837
unique PSMS
6
unique PSMS
6
Genomic Context
Candidate has annotation on SAME strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_11 In blautia CP039126.1
Seq (len = 329 ):
MDLKGRSFLTLKDFTAEEIEYLIDLAAELKEKKKQGVPVDTLKGRNVALIFEKTSTRTRCSFEVAAHDLGMGTTYLDPKGSQIGKKESIRDTARVLGRIYDGIEYRGFGQEIVEELAKYAGVPVWNGLTNEYHPTQMLADLLTIREHLGRVKGVKLVYMGDARYNMGNSLMILCAKMGMHFVACAPKKYFPNDALVKECEAFAKESGATITLTEDVEAGTKNADVIYTDVWVSMGEPDEVWEERIRELTPYKVTKKVMENAGDQAVFLHCLPAFHDLETAIGKEMGARFGLTDMEVTDEVFESEQSVVFDEAENRMHTIKAVMAATLRA
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|231516|-1|6009184-6010189
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
11.546274063037163
unique PSMS
15
unique PSMS
15
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
ornithine carbamoyltransferase [Blautia producta]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
ornithine carbamoyltransferase [Blautia producta] |
0.0 | 100 | 100.000 | WP_018597097 |
Ornithine carbamoyltransferase [Blautia producta] |
0.0 | 100 | 99.696 | QBE95072 |
ornithine carbamoyltransferase [Blautia coccoides] ornithine carbamoyltransferase [Blautia coccoides] ornithine carbamoyltransferase [Blautia coccoides] |
0.0 | 100 | 99.392 | WP_115624054 |
ornithine carbamoyltransferase [Blautia marasmi] |
0.0 | 100 | 96.657 | WP_104803730 |
ornithine carbamoyltransferase [Blautia producta] |
0.0 | 100 | 96.049 | WP_148391818 |
MULTISPECIES: ornithine carbamoyltransferase [Blautia] ornithine carbamoyltransferase [Blautia producta] ornithine carbamoyltransferase [Blautia sp. OF01-4LB] ornithine carbamoyltransferase [Blautia sp. AF13-16] |
0.0 | 100 | 96.049 | WP_103732534 |
ornithine carbamoyltransferase [Blautia producta] |
0.0 | 100 | 96.049 | WP_033143340 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Firmicutes sensu stricto (miscellaneous)] ornithine carbamoyltransferase [Firmicutes bacterium OM04-13BH] ornithine carbamoyltransferase [Firmicutes bacterium CAG:227] |
0.0 | 100 | 92.705 | WP_022303870 |
ornithine carbamoyltransferase [Firmicutes bacterium AM10-47] ornithine carbamoyltransferase [Firmicutes bacterium AM10-47] |
0.0 | 100 | 92.401 | WP_117457113 |
ornithine carbamoyltransferase [Blautia sp. N6H1-15] ornithine carbamoyltransferase [Blautia sp. N6H1-15] |
0.0 | 100 | 88.146 | WP_111917832 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Lachnospiraceae] ornithine carbamoyltransferase [Lachnospiraceae bacterium AM25-22] ornithine carbamoyltransferase [Lachnospiraceae bacterium AM25-40] |
0.0 | 100 | 88.754 | WP_117468507 |
ornithine carbamoyltransferase [Lachnospiraceae bacterium 6_1_63FAA] |
0.0 | 100 | 88.146 | EGG83633 |
ornithine carbamoyltransferase [Firmicutes bacterium] ornithine carbamoyltransferase [Firmicutes bacterium CAG:424] |
0.0 | 100 | 87.842 | WP_022267645 |
ornithine carbamoyltransferase [Blautia hansenii] ornithine carbamoyltransferase [Blautia hansenii DSM 20583] ornithine carbamoyltransferase [Lachnospiraceae bacterium CAG:364] |
0.0 | 100 | 87.842 | WP_003022096 |
ornithine carbamoyltransferase [Lachnoclostridium sp.] |
0.0 | 99 | 86.544 | HBM47369 |
ornithine carbamoyltransferase [Clostridium sp. AM42-4] ornithine carbamoyltransferase [Clostridium sp. AM42-4] |
0.0 | 99 | 85.933 | WP_118726075 |
ornithine carbamoyltransferase [Clostridium sp. OF09-36] ornithine carbamoyltransferase [Clostridium sp. OF09-36] |
0.0 | 99 | 85.627 | WP_118718499 |
ornithine carbamoyltransferase [Hungatella hathewayi] ornithine carbamoyltransferase, catabolic [ [Hungatella hathewayi WAL-18680] |
0.0 | 100 | 86.322 | WP_006780943 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Clostridium] ornithine carbamoyltransferase [Clostridium sp. AF32-12BH] ornithine carbamoyltransferase [Clostridium sp. OM02-18AC] |
0.0 | 99 | 85.933 | WP_118543763 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [Clostridium sp. AF19-22AC] |
0.0 | 99 | 85.321 | WP_118622635 |
ornithine carbamoyltransferase [Ruminococcaceae bacterium] ornithine carbamoyltransferase [Firmicutes bacterium CAG:56] |
0.0 | 100 | 88.146 | WP_022118763 |
ornithine carbamoyltransferase [Merdimonas faecis] |
0.0 | 99 | 84.709 | WP_070087680 |
Ornithine carbamoyltransferase [uncultured Ruminococcus sp.] ornithine carbamoyltransferase [Lachnospiraceae bacterium] |
0.0 | 100 | 88.146 | SCI04441 |
ornithine carbamoyltransferase [Clostridium sp. chh4-2] ornithine carbamoyltransferase [Clostridium sp. chh4-2] |
0.0 | 99 | 85.015 | WP_103230857 |
ornithine carbamoyltransferase [Dorea longicatena] ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 84.404 | WP_117597570 |
Ornithine carbamoyltransferase [uncultured Ruminococcus sp.] |
0.0 | 100 | 88.146 | SCJ88621 |
ornithine carbamoyltransferase [Faecalicatena orotica] ornithine carbamoyltransferase [Faecalicatena orotica] ornithine carbamoyltransferase [Faecalicatena orotica] |
0.0 | 99 | 85.015 | WP_109732445 |
ornithine carbamoyltransferase [Dorea longicatena] Ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 84.098 | WP_144100753 |
ornithine carbamoyltransferase [Faecalicatena fissicatena] |
0.0 | 99 | 84.098 | WP_084727736 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [Clostridium sp. D5] |
0.0 | 99 | 84.098 | WP_009001580 |
ornithine carbamoyltransferase [Dorea longicatena] ornithine carbamoyltransferase [Dorea longicatena DSM 13814] ornithine carbamoyltransferase [Dorea longicatena] ornithine carbamoyltransferase [Dorea longicatena] ornithine carbamoyltransferase [Dorea longicatena] ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 84.098 | WP_006428701 |
ornithine carbamoyltransferase [[Clostridium] scindens] |
0.0 | 99 | 84.709 | WP_025641400 |
ornithine carbamoyltransferase [Clostridiales bacterium VE202-26] |
0.0 | 99 | 84.709 | WP_081724505 |
ornithine carbamoyltransferase [Dorea longicatena] Ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 83.792 | WP_055282153 |
ornithine carbamoyltransferase [Dorea sp. 42_8] |
0.0 | 99 | 84.049 | OLA25618 |
ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 83.792 | WP_138376719 |
ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 83.792 | WP_139009291 |
ornithine carbamoyltransferase [Coprococcus sp. AF27-8] ornithine carbamoyltransferase [Coprococcus sp. AF27-8] |
0.0 | 100 | 84.195 | WP_120091039 |
ornithine carbamoyltransferase [Dorea longicatena] Ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 83.792 | WP_055182552 |
ornithine carbamoyltransferase [Blautia sp. An81] ornithine carbamoyltransferase [Blautia sp. An81] |
0.0 | 100 | 85.410 | WP_087418636 |
ornithine carbamoyltransferase [Dorea longicatena CAG:42] |
0.0 | 99 | 83.792 | CDE17592 |
ornithine carbamoyltransferase [Blautia sp. An46] ornithine carbamoyltransferase [Blautia sp. An46] |
0.0 | 100 | 85.410 | WP_087273505 |
ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 83.486 | WP_028086634 |
ornithine carbamoyltransferase [Coprococcus sp. AF18-48] ornithine carbamoyltransferase [Coprococcus sp. AF18-48] |
0.0 | 100 | 83.891 | WP_120106165 |
ornithine carbamoyltransferase [Hespellia stercorisuis] ornithine carbamoyltransferase [Hespellia stercorisuis DSM 15480] |
0.0 | 99 | 84.098 | WP_073108808 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] |
0.0 | 99 | 84.098 | WP_082203082 |
ornithine carbamoyltransferase [Clostridium sp. AF27-2AA] ornithine carbamoyltransferase [Clostridium sp. AF27-2AA] |
0.0 | 99 | 82.875 | WP_118533232 |
ornithine carbamoyltransferase [Clostridium sp. AM33-3] ornithine carbamoyltransferase [Clostridium sp. AM33-3] |
0.0 | 99 | 82.569 | WP_118732541 |
ornithine carbamoyltransferase [Dorea longicatena] Ornithine carbamoyltransferase [Dorea longicatena] Ornithine carbamoyltransferase [Dorea longicatena] Ornithine carbamoyltransferase [Dorea longicatena] |
0.0 | 99 | 83.486 | WP_055195503 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Clostridiales (miscellaneous)] |
0.0 | 99 | 85.015 | WP_025482646 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [Eubacterium sp. BIOML-A1] ornithine carbamoyltransferase [Eubacterium sp. BIOML-A2] ornithine carbamoyltransferase [Eubacterium sp. am_0171] Ornithine carbamoyltransferase [[Eubacterium] contortum] [Faecalicatena contorta] |
0.0 | 99 | 84.098 | WP_083487081 |
ornithine carbamoyltransferase [Faecalicatena contorta] ornithine carbamoyltransferase [Faecalicatena contorta] ornithine carbamoyltransferase [Faecalicatena contorta] |
0.0 | 99 | 83.180 | WP_109710665 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [Dorea sp. OM02-2LB] ornithine carbamoyltransferase [Ruminococcus sp. AF14-10] ornithine carbamoyltransferase, catabolic [Mediterraneibacter butyricigenes] |
0.0 | 99 | 82.875 | WP_117603668 |
ornithine carbamoyltransferase [Clostridiales bacterium Marseille-P5551] |
0.0 | 99 | 83.486 | WP_122644059 |
MULTISPECIES: ornithine carbamoyltransferase [Lachnospiraceae] ornithine carbamoyltransferase [Lachnospiraceae bacterium 6_1_37FAA] ornithine carbamoyltransferase [Coprococcus sp. HPP0048] ornithine carbamoyltransferase [Faecalimonas umbilicata] ornithine carbamoyltransferase, catabolic [Faecalimonas umbilicata] |
0.0 | 100 | 83.587 | WP_008976891 |
ornithine carbamoyltransferase [Clostridiales bacterium 1_7_47FAA] |
0.0 | 99 | 85.015 | EEQ60245 |
ornithine carbamoyltransferase [Clostridium sp. Marseille-P3244] |
0.0 | 99 | 82.569 | WP_072524517 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [Faecalicatena contorta] ornithine carbamoyltransferase [Hungatella hathewayi] |
0.0 | 99 | 83.792 | WP_081733015 |
ornithine carbamoyltransferase [Clostridiales bacterium TF09-2AC] ornithine carbamoyltransferase [Clostridiales bacterium TF09-2AC] |
0.0 | 99 | 85.015 | WP_120056694 |
ornithine carbamoyltransferase [[Clostridium] aldenense] ornithine carbamoyltransferase [[Clostridium] aldenense] |
0.0 | 99 | 83.792 | WP_117559062 |
ornithine carbamoyltransferase [Coprococcus sp. AM27-12LB] ornithine carbamoyltransferase [Lachnospiraceae bacterium AM25-17] ornithine carbamoyltransferase [Coprococcus sp. AM27-12LB] |
0.0 | 100 | 83.283 | WP_117578486 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Coprococcus] ornithine carbamoyltransferase [Coprococcus sp. AM25-15LB] ornithine carbamoyltransferase [Coprococcus sp. AM25-4LB] |
0.0 | 100 | 83.283 | WP_117500812 |
ornithine carbamoyltransferase [[Clostridium] aldenense] ornithine carbamoyltransferase [Dorea longicatena] ornithine carbamoyltransferase [[Clostridium] aldenense] |
0.0 | 99 | 83.792 | WP_118712640 |
ornithine carbamoyltransferase [Lachnospiraceae bacterium 9_1_43BFAA] ornithine carbamoyltransferase [Lachnospiraceae bacterium 9_1_43BFAA] |
0.0 | 100 | 83.283 | WP_009263262 |
ornithine carbamoyltransferase [Blautia sp. An249] ornithine carbamoyltransferase [Blautia sp. An249] |
0.0 | 99 | 82.317 | WP_087225620 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 83.792 | WP_101884121 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 83.792 | WP_101882432 |
ornithine carbamoyltransferase [Coprococcus sp. HPP0074] ornithine carbamoyltransferase [Coprococcus sp. HPP0074] |
0.0 | 100 | 82.979 | WP_016439605 |
ornithine carbamoyltransferase [[Clostridium] scindens] ornithine carbamoyltransferase [[Clostridium] scindens ATCC 35704] hypothetical protein HMPREF0993_00829 [Lachnospiraceae bacterium 5_1_57FAA] ornithine carbamoyltransferase [[Clostridium] scindens] Ornithine carbamoyltransferase [[Clostridium] scindens ATCC 35704] |
0.0 | 99 | 82.875 | WP_004606507 |
ornithine carbamoyltransferase [Blautia sp. OF03-15BH] ornithine carbamoyltransferase [Blautia sp. OF03-15BH] |
0.0 | 99 | 83.180 | WP_117767303 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus ATCC 29149] ornithine carbamoyltransferase [[Ruminococcus] gnavus CC55_001C] ornithine carbamoyltransferase [Ruminococcus sp.] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 83.180 | WP_004843794 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 83.792 | WP_101878614 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 83.180 | WP_073962679 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 83.486 | WP_101870628 |
ornithine carbamoyltransferase [Clostridium sp. C105KSO13] Ornithine carbamoyltransferase [Clostridium sp. C105KSO13] |
0.0 | 99 | 83.180 | WP_089983490 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase, catabolic [ [[Clostridium] citroniae WAL-17108] ornithine carbamoyltransferase [[Clostridium] citroniae WAL-19142] Ornithine carbamoyltransferase [uncultured Clostridium sp.] ornithine carbamoyltransferase [Clostridium sp. FS41] ornithine carbamoyltransferase [[Clostridium] citroniae] |
0.0 | 99 | 82.875 | WP_007870088 |
ornithine carbamoyltransferase [Ruminococcus sp. AF24-16] ornithine carbamoyltransferase [Ruminococcus sp. AF24-16] |
0.0 | 99 | 82.263 | WP_117874756 |
ornithine carbamoyltransferase [Lachnospiraceae bacterium WCA-9-b2] |
0.0 | 99 | 83.792 | MXP74454 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 82.875 | WP_118227523 |
Ornithine carbamoyltransferase [uncultured Clostridium sp.] |
0.0 | 99 | 82.875 | SCG89675 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [Lachnospiraceae bacterium TM07-2AC] |
0.0 | 99 | 82.875 | WP_117993711 |
ornithine carbamoyltransferase [Ruminococcus sp. TF08-4] ornithine carbamoyltransferase [Ruminococcus sp. TF08-4] |
0.0 | 99 | 82.263 | WP_118187905 |
ornithine carbamoyltransferase [Lachnoclostridium sp. An76] ornithine carbamoyltransferase [Lachnoclostridium sp. An76] |
0.0 | 99 | 83.180 | WP_087178248 |
ornithine carbamoyltransferase [Mediterraneibacter massiliensis] ornithine carbamoyltransferase [Ruminococcus sp. AF18-22] Ornithine carbamoyltransferase [uncultured Clostridium sp.] |
0.0 | 99 | 82.875 | WP_082667433 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [Lachnospiraceae bacterium AM48-27BH] |
0.0 | 99 | 81.651 | WP_118562620 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Ruminococcus] ornithine carbamoyltransferase [Ruminococcus sp. AM49-8] ornithine carbamoyltransferase [Ruminococcus sp. AM49-10BH] |
0.0 | 99 | 82.263 | WP_118113527 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Ruminococcus] ornithine carbamoyltransferase [Ruminococcus sp. TF10-6] ornithine carbamoyltransferase [Ruminococcus sp. AM22-14LB] ornithine carbamoyltransferase [Ruminococcus sp. AF31-14BH] ornithine carbamoyltransferase [Ruminococcus sp. AF19-4LB] ornithine carbamoyltransferase [Ruminococcus sp. AM29-5AC] |
0.0 | 99 | 82.263 | WP_117541472 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] Ornithine carbamoyltransferase [uncultured Ruminococcus sp.] hypothetical protein HMPREF0991_02847 [Lachnospiraceae bacterium 2_1_58FAA] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 82.875 | WP_009245623 |
ornithine carbamoyltransferase [Lachnospiraceae bacterium] Ornithine carbamoyltransferase [uncultured Blautia sp.] |
0.0 | 99 | 81.957 | WP_158422068 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus] ornithine carbamoyltransferase [[Ruminococcus] gnavus] |
0.0 | 99 | 82.875 | WP_118038532 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Bacteria (miscellaneous)] ornithine carbamoyltransferase [bacterium D16-54] ornithine carbamoyltransferase [bacterium D16-56] |
0.0 | 99 | 81.346 | WP_120421780 |
ornithine carbamoyltransferase [Marvinbryantia formatexigens] ornithine carbamoyltransferase [Marvinbryantia formatexigens DSM 14469] ornithine carbamoyltransferase [Marvinbryantia formatexigens] |
0.0 | 99 | 82.209 | WP_006861564 |
ornithine carbamoyltransferase [[Ruminococcus] gnavus CAG:126] |
0.0 | 99 | 82.875 | CCZ67661 |
ornithine carbamoyltransferase [Lachnospiraceae bacterium] |
0.0 | 99 | 82.263 | HAX51569 |
ornithine carbamoyltransferase [[Eubacterium] cellulosolvens] |
0.0 | 100 | 81.155 | WP_027870137 |
ornithine carbamoyltransferase [Lachnoclostridium sp. An131] ornithine carbamoyltransferase [Lachnoclostridium sp. An131] |
0.0 | 100 | 81.763 | WP_087166219 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [Ruminococcus faecis] ornithine carbamoyltransferase [Ruminococcus sp. CAG:55] Ornithine carbamoyltransferase [[Ruminococcus] torques] Ornithine carbamoyltransferase [[Ruminococcus] torques] |
0.0 | 99 | 81.957 | WP_020436571 |
MULTISPECIES: ornithine carbamoyltransferase [Clostridiales] ornithine carbamoyltransferase [[Ruminococcus] torques L2-14] ornithine carbamoyltransferase [Ruminococcus sp. AM16-34] ornithine carbamoyltransferase [Ruminococcus sp. AM09-18-1] ornithine carbamoyltransferase [Ruminococcus sp. AF32-2AC] ornithine carbamoyltransferase [Ruminococcus sp. AM57-5] |
0.0 | 99 | 81.957 | WP_015530001 |
ornithine carbamoyltransferase [Lachnoclostridium sp. An169] ornithine carbamoyltransferase [Lachnoclostridium sp. An169] |
0.0 | 99 | 82.263 | WP_087160615 |
MULTISPECIES: ornithine carbamoyltransferase [unclassified Blautia] ornithine carbamoyltransferase [Blautia sp. AF26-2] ornithine carbamoyltransferase [Blautia sp. OF09-25XD] |
0.0 | 100 | 82.371 | WP_117801611 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_12 In clostri CP040626.1
Seq (len = 81 ):
MELLSVVTKELYPSIAKKYNTTASRVERAIRHAIEVAWGRGQIEAINKLFGYTVHNDKGKPTNSEFIAIIADKLRLKNKVS
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|378256|-1|2379988-2380273
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
5.432189708570502
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
sporulation transcription factor Spo0A [Clostridium sp.]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein ClosIBUN125C_CONTIG42g02485 [Clostridium sp. IBUN125C] hypothetical protein ClosIBUN13A_CONTIG250g04042 [Clostridium sp. IBUN13A] hypothetical protein ClosIBUN62F_CONTIG33g01221 [Clostridium sp. IBUN62F] |
3.69e-52 | 100 | 100.000 | KJZ86439 |
hypothetical protein Cbu04g_14410 [Clostridium butyricum] hypothetical protein CBU03nite_26470 [Clostridium butyricum] |
4.09e-52 | 100 | 100.000 | BBK76433 |
sporulation transcription factor Spo0A [Clostridium butyricum] sporulation transcription factor Spo0A [Clostridium butyricum DKU-01] sporulation transcription factor Spo0A [Clostridium butyricum] hypothetical protein CBU01nite_13100 [Clostridium butyricum] Stage 0 sporulation protein A [Clostridium neonatale] |
1.75e-51 | 100 | 98.765 | WP_003426323 |
hypothetical protein [Clostridium butyricum] hypothetical protein CBU02nite_07450 [Clostridium butyricum] |
1.9e-51 | 100 | 98.765 | WP_033127846 |
sporulation transcription factor Spo0A [Clostridium sp.] |
4.08e-51 | 100 | 98.765 | HCW52670 |
hypothetical protein ATN24_11910 [Clostridium butyricum] hypothetical protein ATD26_10815 [Clostridium butyricum] hypothetical protein AZ909_10360 [Clostridium butyricum] hypothetical protein BBB49_10540 [Clostridium butyricum] |
1.36e-50 | 100 | 97.531 | ALP90812 |
stage 0 sporulation protein A [Clostridium botulinum] |
1.46e-50 | 100 | 96.296 | OSA90559 |
Sporulation initiation factor Spo0A [Clostridium sp. DL-VIII] |
3.25e-50 | 100 | 96.296 | EHI99784 |
sporulation transcription factor Spo0A [Clostridium butyricum] sporulation transcription factor Spo0A [Clostridium butyricum 5521] sporulation transcription factor Spo0A [Clostridium butyricum E4 str. BoNT E BL5262] sporulation transcription factor Spo0A [Clostridium butyricum] chemotaxis protein CheY [Clostridium butyricum] chemotaxis protein CheY [Clostridium butyricum] |
1.14e-49 | 100 | 98.765 | WP_003414889 |
Stage 0 sporulation protein A-like protein [Clostridium butyricum DORA_1] |
1.24e-49 | 100 | 95.062 | ETI87767 |
MULTISPECIES: sporulation transcription factor Spo0A [Clostridium] sporulation transcription factor Spo0A [Clostridium butyricum DKU-01] sporulation transcription factor Spo0A [Clostridium butyricum] sporulation transcription factor Spo0A [Clostridium butyricum] sporulation transcription factor Spo0A [Clostridium butyricum] sporulation transcription factor Spo0A [Clostridium butyricum] |
1.3e-49 | 100 | 98.765 | WP_003426286 |
hypothetical protein HMPREF3070_05275 [Clostridium sp. HMSC19A10] |
1.35e-49 | 100 | 95.062 | OFS24310 |
sporulation transcription factor Spo0A [Clostridium saccharobutylicum] stage 0 sporulation protein A [Clostridium saccharobutylicum] |
1.66e-49 | 100 | 97.531 | WP_077866520 |
sporulation transcription factor Spo0A [Clostridium saccharobutylicum] stage 0 sporulation protein A [Clostridium saccharobutylicum DSM 13864] stage 0 sporulation protein A [Clostridium saccharobutylicum] stage 0 sporulation protein A [Clostridium saccharobutylicum] stage 0 sporulation protein A [Clostridium saccharobutylicum] stage 0 sporulation protein A [Clostridium saccharobutylicum] |
1.66e-49 | 100 | 97.531 | WP_022746797 |
sporulation transcription factor Spo0A [Clostridium disporicum] sporulation transcription factor Spo0A [Clostridium disporicum] |
1.93e-49 | 100 | 98.765 | WP_055265804 |
sporulation transcription factor Spo0A [Clostridium cuniculi] |
1.97e-49 | 100 | 98.765 | WP_133016732 |
stage 0 sporulation protein A [Clostridium botulinum] |
1.99e-49 | 100 | 93.827 | OSA98002 |
sporulation transcription factor Spo0A [Clostridium sp. CL-2] |
2.01e-49 | 100 | 98.765 | WP_032118905 |
sporulation transcription factor Spo0A [Clostridium chromiireducens] sporulation transcription factor Spo0A [Clostridium chromiireducens] stage 0 sporulation protein A [Clostridium chromiireducens] sporulation transcription factor Spo0A [Clostridium chromiireducens] |
2.16e-49 | 100 | 97.531 | WP_079439513 |
sporulation transcription factor Spo0A [Clostridium butyricum 60E.3] Stage 0 sporulation protein A-like protein [Clostridium butyricum DORA_1] |
2.48e-49 | 100 | 98.765 | ENZ34233 |
stage 0 sporulation protein A [Clostridium sp. MF28] |
2.49e-49 | 100 | 97.531 | AMQ96035 |
sporulation transcription factor Spo0A [Clostridium beijerinckii] stage 0 sporulation protein A [Clostridium beijerinckii] |
2.6e-49 | 100 | 97.531 | WP_077853700 |
MULTISPECIES: sporulation transcription factor Spo0A [Clostridium] RecName: Full=Stage 0 sporulation protein A homolog [Clostridium beijerinckii NCIMB 8052] response regulator receiver protein [Clostridium beijerinckii ATCC 35702] response regulator receiver protein [Clostridium beijerinckii NCIMB 8052] sporulation transcription factor Spo0A [Clostridium beijerinckii] stage 0 sporulation protein A [Clostridium beijerinckii] sporulation transcription factor Spo0A [Clostridium beijerinckii] |
2.6e-49 | 100 | 97.531 | WP_011969036 |
unnamed protein product sporulation transcription factor Spo0A [Clostridium beijerinckii NRRL B-598] stage 0 sporulation protein A [Clostridium beijerinckii] sporulation transcription factor Spo0A [Clostridium diolis] sporulation transcription factor Spo0A [Clostridium diolis] response regulator receiver protein [Clostridium beijerinckii] |
2.72e-49 | 100 | 97.531 | WP_023974703 |
sporulation transcription factor Spo0A [Clostridium septicum] sporulation transcription factor Spo0A [Clostridium septicum] sporulation transcription factor Spo0A [Clostridium septicum] |
2.76e-49 | 100 | 97.531 | WP_066679010 |
sporulation transcription factor Spo0A [Clostridium sp. LS] sporulation transcription factor Spo0A [Clostridium sp. Maddingley MBC34-26] |
2.76e-49 | 100 | 97.531 | WP_008417961 |
sporulation transcription factor Spo0A [Clostridium beijerinckii] |
2.93e-49 | 100 | 97.531 | WP_026886491 |
spo0A protein [Clostridium sp. CAG:221] |
3.24e-49 | 100 | 97.531 | CDB15353 |
MULTISPECIES: sporulation transcription factor Spo0A [unclassified Clostridium] sporulation transcriptional activator Spo0A [Clostridium sp. DL-VIII] stage 0 sporulation protein A [Clostridium sp. BL-8] |
3.89e-49 | 100 | 96.296 | WP_009170415 |
sporulation transcription factor Spo0A [Clostridium sp. Ade.TY] |
4.15e-49 | 100 | 96.296 | WP_024615049 |
sporulation transcription factor Spo0A [Clostridium sp. DSM 8431] two-component system, response regulator, stage 0 sporulation protein A [Clostridium sp. DSM 8431] |
7.26e-49 | 100 | 97.531 | WP_090012558 |
sporulation transcription factor Spo0A [Clostridium thermobutyricum] sporulation transcription factor Spo0A [Clostridium thermobutyricum] stage 0 sporulation protein A [Clostridium thermobutyricum DSM 4928] |
7.59e-49 | 100 | 95.062 | WP_002597732 |
sporulation transcription factor Spo0A [Clostridium baratii] sporulation transcription factor Spo0A [Clostridium baratii] sporulation transcription factor Spo0A [Clostridium baratii] sporulation transcription factor Spo0A [Clostridium baratii] sporulation transcription factor Spo0A [Clostridium baratii] response regulator receiver protein [Clostridium baratii] |
1.01e-48 | 100 | 95.062 | WP_055206707 |
sporulation transcription factor Spo0A [Clostridium baratii] sporulation transcription factor Spo0A [Clostridium baratii str. Sullivan] sporulation transcription factor Spo0A [Clostridium baratii] chemotaxis protein CheY [Clostridium baratii] response regulator receiver protein [Clostridium baratii] |
1.01e-48 | 100 | 95.062 | WP_039315886 |
sporulation transcription factor Spo0A [Clostridium cadaveris] sporulation transcription factor Spo0A [Clostridium cadaveris] two-component system, response regulator, stage 0 sporulation protein A [Clostridium cadaveris] |
1.08e-48 | 100 | 95.062 | WP_027638378 |
MULTISPECIES: sporulation transcription factor Spo0A [Clostridium] sporulation transcription factor Spo0A [Clostridium botulinum B str. Eklund 17B (NRP)] stage 0 sporulation protein A [Clostridium botulinum B str. Eklund 17B (NRP)] |
1.25e-48 | 100 | 96.296 | WP_012424325 |
sporulation transcription factor Spo0A [Clostridium sp. ND2] |
1.25e-48 | 100 | 93.827 | WP_055071063 |
sporulation transcription factor Spo0A [Clostridium botulinum] sporulation transcription factor Spo0A [Clostridium botulinum 202F] chemotaxis protein CheY [Clostridium botulinum] chemotaxis protein CheY [Clostridium botulinum] chemotaxis protein CheY [Clostridium botulinum] |
1.33e-48 | 100 | 96.296 | WP_035786439 |
sporulation transcription factor Spo0A [Clostridium mediterraneense] |
1.36e-48 | 100 | 93.827 | WP_066873072 |
Stage 0 sporulation protein G [uncultured Clostridium sp.] |
1.41e-48 | 100 | 97.531 | SCJ54008 |
sporulation transcription factor Spo0A [Clostridium taeniosporum] sporulation transcription factor Spo0A [Clostridium taeniosporum] |
1.55e-48 | 100 | 96.296 | WP_069680039 |
sporulation transcription factor Spo0A [Desnuesiella massiliensis] |
1.73e-48 | 100 | 93.827 | WP_055667700 |
sporulation transcription factor Spo0A [Clostridium botulinum] |
1.77e-48 | 100 | 96.296 | WP_061281878 |
sporulation transcription factor Spo0A [Clostridium botulinum] sporulation transcription factor Spo0A [Clostridium botulinum E1 str. 'BoNT E Beluga'] chemotaxis protein CheY [Clostridium botulinum] chemotaxis protein CheY [Clostridium botulinum] chemotaxis protein CheY [Clostridium botulinum] chemotaxis protein CheY [Clostridium botulinum] |
1.81e-48 | 100 | 96.296 | WP_003373158 |
sporulation transcription factor Spo0A [Clostridium botulinum] sporulation transcription factor Spo0A [Clostridium botulinum E3 str. Alaska E43] |
1.85e-48 | 100 | 96.296 | WP_012451750 |
sporulation transcription factor Spo0A [Clostridium polynesiense] |
1.97e-48 | 100 | 93.827 | WP_040211850 |
sporulation transcription factor Spo0A [Clostridium paraputrificum] sporulation transcription factor Spo0A [Clostridium paraputrificum] sporulation transcription factor Spo0A [Clostridium paraputrificum] response regulator receiver protein [Clostridium paraputrificum] response regulator receiver protein [Clostridium paraputrificum] response regulator receiver protein [Clostridium paraputrificum] |
2.2e-48 | 100 | 95.062 | WP_027097704 |
sporulation transcription factor Spo0A [Clostridium amylolyticum] two-component system, response regulator, stage 0 sporulation protein A [Clostridium amylolyticum] |
2.3e-48 | 100 | 93.827 | WP_073009318 |
sporulation transcription factor Spo0A [Clostridium celatum] |
2.36e-48 | 100 | 96.296 | WP_040419320 |
MULTISPECIES: sporulation transcription factor Spo0A [Clostridium] response regulator receiver protein [Clostridium disporicum] Stage 0 sporulation protein G [uncultured Clostridium sp.] |
2.37e-48 | 100 | 96.296 | WP_042396781 |
sporulation transcription factor Spo0A [Clostridium disporicum] response regulator receiver protein [Clostridium disporicum] Stage 0 sporulation protein G [uncultured Clostridium sp.] |
2.43e-48 | 100 | 96.296 | WP_055290978 |
sporulation transcription factor Spo0A [Clostridium sporogenes] |
2.62e-48 | 100 | 95.062 | WP_154840107 |
MULTISPECIES: sporulation transcription factor Spo0A [Clostridium] |
2.67e-48 | 100 | 95.062 | WP_049179126 |
phosphorylation-activated transcription factor [Clostridium perfringens str. 13] phosphorylation-activated transcription factor [Clostridium perfringens] |
2.68e-48 | 100 | 90.123 | BAB81518 |
sporulation transcription factor Spo0A [Clostridium paraputrificum] |
2.85e-48 | 100 | 95.062 | WP_156561236 |
sporulation transcription factor Spo0A [Clostridium sp. CT4] sporulation transcription factor Spo0A [Clostridium sp. CT4] |
3.17e-48 | 100 | 93.827 | WP_128212868 |
sporulation transcription factor Spo0A [Clostridium celatum DSM 1785] |
3.27e-48 | 100 | 96.296 | EKY27009 |
sporulation transcription factor Spo0A [Clostridium sp. HBUAS56017] |
3.42e-48 | 100 | 95.062 | WP_143314313 |
sporulation transcription factor Spo0A [Clostridium butyricum] sporulation transcription factor Spo0A [Clostridium butyricum] |
3.73e-48 | 100 | 97.531 | WP_064062216 |
Stage 0 sporulation protein A [Clostridium vincentii] |
4.1e-48 | 100 | 93.827 | PRR78705 |
sporulation transcription factor Spo0A [Clostridium uliginosum] two-component system, response regulator, stage 0 sporulation protein A [Clostridium uliginosum] |
5.48e-48 | 100 | 95.062 | WP_090091634 |
sporulation transcription factor Spo0A [Clostridium sp. 29_15] spo0A protein [Clostridium sp. CAG:265] |
6.81e-48 | 100 | 95.062 | OKZ85037 |
MULTISPECIES: sporulation transcription factor Spo0A [Clostridium] sporulation transcription factor Spo0A [Clostridium sp. 7_2_43FAA] |
6.96e-48 | 100 | 93.827 | WP_008679108 |
sporulation transcription factor Spo0A [Clostridium gasigenes] two-component system, response regulator, stage 0 sporulation protein A [Clostridium gasigenes] |
7.3e-48 | 100 | 96.296 | WP_089965737 |
sporulation transcription factor Spo0A [Clostridium cavendishii] two-component system, response regulator, stage 0 sporulation protein A [Clostridium cavendishii DSM 21758] |
7.63e-48 | 100 | 92.593 | WP_072987194 |
sporulation transcription factor Spo0A [Clostridium sartagoforme] response regulator receiver protein [Clostridium sartagoforme AAU1] |
7.67e-48 | 100 | 93.827 | WP_016208666 |
sporulation transcription factor Spo0A [Clostridium sp. C8] chemotaxis protein CheY [Clostridium sp. C8] |
8.37e-48 | 100 | 93.827 | WP_047000891 |
sporulation transcription factor Spo0A [Clostridium sp. SYSU GA15002T] |
8.65e-48 | 100 | 92.593 | WP_139904288 |
sporulation transcription factor Spo0A [Clostridium chauvoei] Putative Response regulator receiver protein [Clostridium chauvoei JF4335] sporulation transcription factor Spo0A [Clostridium chauvoei] sporulation transcription factor Spo0A [Clostridium chauvoei] sporulation transcription factor Spo0A [Clostridium chauvoei] Putative Response regulator receiver protein [Clostridium chauvoei JF4335] |
8.93e-48 | 100 | 93.827 | WP_021875793 |
sporulation transcription factor Spo0A [Clostridium intestinale] stage 0 sporulation protein A [Clostridium intestinale URNW] two-component system, response regulator, stage 0 sporulation protein A [Clostridium intestinale DSM 6191] |
1e-47 | 100 | 92.593 | WP_021801463 |
sporulation transcription factor Spo0A [Clostridium frigidicarnis] two-component system, response regulator, stage 0 sporulation protein A [Clostridium frigidicarnis] |
1.25e-47 | 100 | 91.358 | WP_090039134 |
sporulation transcription factor Spo0A [Clostridium tertium] |
1.29e-47 | 100 | 92.593 | WP_156627616 |
sporulation transcription factor Spo0A [Clostridium hydrogeniformans] |
1.32e-47 | 100 | 91.358 | WP_027632920 |
sporulation transcription factor Spo0A [Clostridium isatidis] sporulation transcription factor Spo0A [Clostridium isatidis] |
1.41e-47 | 100 | 92.593 | WP_119864832 |
sporulation transcription factor Spo0A [Clostridium puniceum] stage 0 sporulation protein A [Clostridium puniceum] |
1.51e-47 | 100 | 93.827 | WP_077846456 |
sporulation transcription factor Spo0A [Clostridium perfringens] |
1.64e-47 | 100 | 93.827 | WP_142690178 |
sporulation transcription factor Spo0A [Clostridium beijerinckii] sporulation transcription factor Spo0A [Clostridium beijerinckii] |
1.67e-47 | 100 | 95.062 | WP_158519238 |
sporulation transcription factor Spo0A [Clostridium sartagoforme] sporulation transcription factor Spo0A [Clostridium sartagoforme] |
1.72e-47 | 100 | 92.593 | WP_136005441 |
sporulation transcription factor Spo0A [Clostridium sp.] |
2.37e-47 | 100 | 91.358 | HCW05711 |
sporulation transcription factor Spo0A [Clostridium sp. N3C] Stage 0 sporulation protein G [Clostridium sp. N3C] |
2.4e-47 | 100 | 91.358 | WP_074364172 |
sporulation transcription factor Spo0A [Clostridium perfringens] Spo0A protein [Clostridium perfringens SM101] stage 0 sporulation protein A [Clostridium perfringens] Spo0A protein [Clostridium perfringens] Spo0A protein [Clostridium perfringens] Spo0A protein [Clostridium perfringens] |
3.32e-47 | 100 | 91.358 | WP_011592684 |
sporulation transcription factor Spo0A [Clostridium fallax] two-component system, response regulator, stage 0 sporulation protein A [Clostridium fallax] protein Spo0A [Clostridium fallax] |
3.61e-47 | 100 | 91.358 | WP_072896703 |
sporulation transcription factor Spo0A [Clostridium amazonitimonense] |
4.32e-47 | 99 | 93.750 | WP_032121664 |
sporulation transcription factor Spo0A [Clostridium saccharoperbutylacetonicum] response regulator receiver protein [Clostridium saccharoperbutylacetonicum N1-4(HMT)] stage 0 sporulation protein A [Clostridium saccharoperbutylacetonicum N1-4(HMT)] stage 0 sporulation protein A [Clostridium saccharoperbutylacetonicum] |
5.94e-47 | 100 | 93.827 | WP_015392838 |
sporulation transcription factor Spo0A [Clostridiaceae bacterium WCA-383-APC-5B] sporulation transcription factor Spo0A [Clostridiaceae bacterium WCA-383-APC-5B] |
7.03e-47 | 100 | 91.358 | WP_154529930 |
sporulation transcription factor Spo0A [Clostridium butyricum] |
7.14e-47 | 98 | 97.468 | WP_058229780 |
sporulation transcription factor Spo0A [Clostridium oryzae] stage 0 sporulation protein A [Clostridium oryzae] |
7.19e-47 | 100 | 90.123 | WP_079422691 |
MULTISPECIES: sporulation transcription factor Spo0A [Clostridium] sporulation transcription factor Spo0A [Clostridium neonatale] sporulation transcription factor Spo0A [Clostridium neonatale] Stage 0 sporulation protein A [Clostridium neonatale] response regulator receiver protein [Clostridium carnis] |
7.3e-47 | 100 | 92.593 | WP_058294968 |
sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] |
8.27e-47 | 100 | 90.123 | WP_151232639 |
sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] |
8.45e-47 | 100 | 90.123 | WP_126963413 |
sporulation transcription factor Spo0A [Clostridium perfringens] |
8.45e-47 | 100 | 90.123 | WP_096516501 |
sporulation transcription factor Spo0A [Clostridium perfringens] Spo0A protein [Clostridium perfringens F262] sporulation transcription factor Spo0A [Clostridium perfringens] |
9.12e-47 | 100 | 90.123 | WP_003481857 |
sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] |
9.52e-47 | 100 | 90.123 | WP_139933744 |
sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] |
9.52e-47 | 100 | 90.123 | WP_111945775 |
sporulation transcription factor Spo0A [Clostridium perfringens] |
9.63e-47 | 100 | 90.123 | WP_124041214 |
sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] |
1.02e-46 | 100 | 90.123 | WP_025648198 |
stage 0 sporulation protein A [Clostridium perfringens CPE str. F4969] |
1.08e-46 | 100 | 90.123 | AAP97081 |
sporulation transcription factor Spo0A [Clostridium perfringens] |
1.08e-46 | 100 | 90.123 | WP_150541174 |
sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens WAL-14572] sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] Spo0A protein [Clostridium perfringens] |
1.1e-46 | 100 | 90.123 | WP_003478335 |
sporulation transcription factor Spo0A [Clostridium perfringens] sporulation transcription factor Spo0A [Clostridium perfringens] |
1.17e-46 | 100 | 90.123 | WP_131440316 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_13 In ecoli U00096.3
Seq (len = 38 ):
MSKVGINGFGRIGRLVLGRLLEVKSNIDVVAINDLTSP
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|285440|-1|1490599-1490725
Transkriptom
88.0% of gene length expressed over median expression of contig.
ŝ
1.8229447128417018
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
succinate--CoA ligase subunit alpha [Bacteroides caccae]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] hypothetical protein Btheta7330_02408 [Bacteroides thetaiotaomicron] conserved hypothetical protein [Bacteroides sp. 1_1_14] hypothetical protein C799_01035 [Bacteroides thetaiotaomicron dnLKV9] putative uncharacterized protein [Bacteroides thetaiotaomicron CAG:40] hypothetical protein SAMN02910431_02010 [Bacteroides sp. AR20] |
7.9e-31 | 100 | 100.000 | ADX07083 |
Uncharacterised protein [Bacteroides thetaiotaomicron] hypothetical protein SAMN02910322_00316 [Bacteroides thetaiotaomicron] |
2.53e-30 | 100 | 98.246 | CUP79327 |
uncharacterized protein BN607_01607 [Bacteroides faecis CAG:32] Uncharacterised protein [Bacteroides thetaiotaomicron] hypothetical protein SAMN05444400_13126 [Bacteroides faecis MAJ27] |
5.12e-30 | 100 | 96.491 | CDC88241 |
hypothetical protein KGMB02408_14080 [Bacteroides sp. KCTC 15687] |
1.38e-29 | 100 | 94.737 | GCB34463 |
hypothetical protein SAMN05444349_12516 [Bacteroides faecichinchillae] |
4.92e-29 | 100 | 92.982 | SHF56210 |
hypothetical protein BACOVA_02524 [Bacteroides ovatus ATCC 8483] hypothetical protein BSGG_4517 [Bacteroides sp. D2] hypothetical protein BACOV975_03625 [Bacteroides ovatus V975] |
6.22e-29 | 100 | 92.982 | EDO12023 |
hypothetical protein C5Z02_05955 [Bacteroides ovatus] hypothetical protein DXA11_22120 [Bacteroides sp. AM56-10ce] hypothetical protein DWY64_03260 [Bacteroides ovatus] hypothetical protein DW890_21665 [Bacteroides ovatus] hypothetical protein DW071_25550 [Bacteroides ovatus] |
6.86e-29 | 100 | 92.982 | PQL41733 |
hypothetical protein BSCG_04781 [Bacteroides sp. 2_2_4] |
7.53e-29 | 100 | 92.982 | EEO57852 |
hypothetical protein Bovatus_00835 [Bacteroides ovatus] conserved hypothetical protein [Bacteroides ovatus SD CMC 3f] hypothetical protein HMPREF1017_00883 [Bacteroides ovatus 3_8_47FAA] hypothetical protein HMPREF1070_03175 [Bacteroides ovatus CL03T12C18] hypothetical protein HMPREF1069_00533 [Bacteroides ovatus CL02T12C04] hypothetical protein M088_2248 [Bacteroides ovatus str. 3725 D1 iv] hypothetical protein M082_2878 [Bacteroides fragilis str. 3725 D9 ii] hypothetical protein M089_1105 [Bacteroides ovatus str. 3725 D9 iii] uncharacterized protein BN541_03754 [Bacteroides ovatus CAG:22] |
1.1e-28 | 100 | 92.982 | ALJ45493 |
hypothetical protein HMPREF0102_01534 [Bacteroides sp. 2_1_22] |
2.17e-28 | 100 | 91.228 | EEZ04366 |
hypothetical protein DW691_02000 [Bacteroides xylanisolvens] |
3.33e-28 | 100 | 91.228 | RHF36758 |
hypothetical protein HMPREF9009_03308 [Bacteroides sp. 3_1_13] |
3.84e-28 | 100 | 91.228 | KMW76778 |
conserved hypothetical protein [Bacteroides xylanisolvens SD CC 2a] conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein HMPREF1074_01748 [Bacteroides xylanisolvens CL03T12C04] hypothetical protein BN891_45320 [Bacteroides xylanisolvens SD CC 2a] hypothetical protein BN890_10120 [Bacteroides xylanisolvens SD CC 1b] |
3.88e-28 | 100 | 91.228 | EFF55777 |
hypothetical protein SAMN04487924_14621 [Bacteroides xylanisolvens] hypothetical protein SAMN05216250_14530 [Bacteroides xylanisolvens] |
1.5e-27 | 100 | 89.474 | SEB17374 |
hypothetical protein HMPREF1068_02481 [Bacteroides nordii CL02T12C05] |
3.24e-26 | 96 | 89.091 | EIY49922 |
hypothetical protein BSHG_2511 [Bacteroides sp. 3_2_5] hypothetical protein HMPREF0101_01437 [Bacteroides fragilis] hypothetical protein HMPREF1055_00495 [Bacteroides fragilis CL07T00C01] hypothetical protein HMPREF1067_03220 [Bacteroides fragilis CL03T12C07] hypothetical protein HMPREF1066_02170 [Bacteroides fragilis CL03T00C08] hypothetical protein HMPREF1079_03557 [Bacteroides fragilis CL05T00C42] hypothetical protein HMPREF1080_03186 [Bacteroides fragilis CL05T12C13] hypothetical protein HMPREF1056_02425 [Bacteroides fragilis CL07T12C05] hypothetical protein HMPREF1204_02790 [Bacteroides fragilis HMW 615] hypothetical protein M078_2290 [Bacteroides fragilis str. 2-F-2 #7] hypothetical protein M120_2548 [Bacteroides fragilis str. 3783N1-8] hypothetical protein M129_2412 [Bacteroides fragilis str. S6R5] hypothetical protein BF9343_2266 [Bacteroides fragilis NCTC 9343] hypothetical protein BF638R_2359 [Bacteroides fragilis 638R] putative uncharacterized protein [Bacteroides fragilis CAG:47] |
1.04e-25 | 98 | 87.500 | EES86222 |
hypothetical protein M103_2408 [Bacteroides fragilis str. 1007-1-F #9] |
4.94e-25 | 98 | 85.714 | EYA24982 |
hypothetical protein BFAG_01882 [Bacteroides fragilis 3_1_12] |
1.64e-24 | 96 | 83.636 | EFR53187 |
hypothetical protein HMPREF1214_02347 [Bacteroides sp. HPS0048] |
2.04e-24 | 96 | 87.273 | EOA57952 |
hypothetical protein HMPREF1205_03839 [Bacteroides fragilis HMW 616] hypothetical protein HMPREF1203_00475 [Bacteroides fragilis HMW 610] predicted protein [Bacteroides fragilis CAG:558] |
6.18e-24 | 96 | 81.818 | EKA81881 |
hypothetical protein HMPREF9447_00386 [Bacteroides oleiciplenus YIT 12058] |
1.77e-21 | 96 | 78.182 | EKU92729 |
hypothetical protein BHV75_06160 [Bacteroides oleiciplenus] |
9.05e-21 | 96 | 76.364 | OKZ12059 |
hypothetical protein HMPREF1062_04199 [Bacteroides cellulosilyticus CL02T12C19] hypothetical protein AA416_03046 [Bacteroides cellulosilyticus] |
2.7e-20 | 96 | 72.727 | EIY26434 |
hypothetical protein SAMN05192581_11014 [Bacteroides ovatus] |
6.98e-19 | 77 | 90.909 | SDB79659 |
hypothetical protein M077_2369 [Bacteroides fragilis str. 2-F-2 #5] hypothetical protein M080_2075 [Bacteroides fragilis str. 3397 T10] hypothetical protein M145_2117 [Bacteroides fragilis str. 34-F-2 #13] hypothetical protein M117_2133 [Bacteroides fragilis str. 3774 T13] hypothetical protein M118_2095 [Bacteroides fragilis str. 3783N1-2] hypothetical protein M121_2046 [Bacteroides fragilis str. 3783N2-1] hypothetical protein M122_1996 [Bacteroides fragilis str. 3976T7] hypothetical protein M111_2000 [Bacteroides fragilis str. 3986T(B)10] hypothetical protein M085_1993 [Bacteroides fragilis str. 3986 N(B)19] hypothetical protein M083_2215 [Bacteroides fragilis str. 3986 T(B)9] hypothetical protein M124_1942 [Bacteroides fragilis str. 3988T(B)14] hypothetical protein M084_2016 [Bacteroides fragilis str. 3988 T1] hypothetical protein M079_2301 [Bacteroides fragilis str. 3996 N(B) 6] hypothetical protein M125_2736 [Bacteroides fragilis str. 3998T(B)3] hypothetical protein M081_2387 [Bacteroides fragilis str. 3998 T(B) 4] hypothetical protein M074_2337 [Bacteroides fragilis str. DS-166] hypothetical protein M071_2060 [Bacteroides fragilis str. Ds-233] hypothetical protein M067_2356 [Bacteroides fragilis str. J-143-4] hypothetical protein M136_2295 [Bacteroides fragilis str. S36L11] hypothetical protein M076_2255 [Bacteroides fragilis str. 2-F-2 #4] hypothetical protein M109_0945 [Bacteroides fragilis str. 3397 N2] hypothetical protein M108_2121 [Bacteroides fragilis str. 3397 T14] hypothetical protein M116_2379 [Bacteroides fragilis str. 3719 A10] hypothetical protein M144_2292 [Bacteroides fragilis str. 3-F-2 #6] hypothetical protein M069_2498 [Bacteroides fragilis str. B1 (UDC16-1)] hypothetical protein M068_2283 [Bacteroides fragilis str. J38-1] hypothetical protein M065_3079 [Bacteroides fragilis str. Korea 419] hypothetical protein M087_2152 [Bacteroides fragilis str. S23 R14] hypothetical protein M126_2574 [Bacteroides fragilis str. S6L3] hypothetical protein M130_2361 [Bacteroides fragilis str. S6R6] hypothetical protein M106_3185 [Bacteroides fragilis str. 1009-4-F #10] hypothetical protein M105_2690 [Bacteroides fragilis str. 1009-4-F #7] hypothetical protein M075_2474 [Bacteroides fragilis str. 20793-3] hypothetical protein M110_2184 [Bacteroides fragilis str. 3397 N3] hypothetical protein M115_2195 [Bacteroides fragilis str. 3719 T6] hypothetical protein M114_2091 [Bacteroides fragilis str. 3986 N(B)22] hypothetical protein M112_2286 [Bacteroides fragilis str. 3986 T(B)13] hypothetical protein M070_2186 [Bacteroides fragilis str. A7 (UDC12-2)] hypothetical protein M139_2304 [Bacteroides fragilis str. S23L24] hypothetical protein M132_2088 [Bacteroides fragilis str. S24L15] hypothetical protein M133_2161 [Bacteroides fragilis str. S24L26] hypothetical protein M134_2287 [Bacteroides fragilis str. S24L34] hypothetical protein M137_2804 [Bacteroides fragilis str. S36L12] hypothetical protein M135_2569 [Bacteroides fragilis str. S36L5] hypothetical protein M141_2144 [Bacteroides fragilis str. S38L5] hypothetical protein M128_2427 [Bacteroides fragilis str. S6L8] hypothetical protein M119_2389 [Bacteroides fragilis str. 3783N1-6] hypothetical protein M140_2102 [Bacteroides fragilis str. S38L3] hypothetical protein M066_2332 [Bacteroides fragilis str. I1345] hypothetical protein M138_2248 [Bacteroides fragilis str. S23L17] hypothetical protein M127_2338 [Bacteroides fragilis str. S6L5] hypothetical protein M131_2357 [Bacteroides fragilis str. S6R8] hypothetical protein M113_2280 [Bacteroides fragilis str. 3986 N3] hypothetical protein AC094_22590 [Bacteroides fragilis] |
5.37e-18 | 81 | 84.783 | EXY18161 |
hypothetical protein M072_2076 [Bacteroides fragilis str. DS-208] |
9.51e-18 | 81 | 82.609 | EXZ05479 |
hypothetical protein M123_2372 [Bacteroides fragilis str. 3976T8] |
2.07e-17 | 81 | 82.609 | EXZ73195 |
hypothetical protein M101_2191 [Bacteroides fragilis str. 1007-1-F #8] hypothetical protein M086_1953 [Bacteroides fragilis str. S13 L11] hypothetical protein M147_2400 [Bacteroides fragilis str. 1007-1-F #4] hypothetical protein M100_2366 [Bacteroides fragilis str. 1007-1-F #7] hypothetical protein M104_2229 [Bacteroides fragilis str. 1007-1-F #10] hypothetical protein M146_2734 [Bacteroides fragilis str. 1007-1-F #3] hypothetical protein M148_2396 [Bacteroides fragilis str. 1007-1-F #5] hypothetical protein M149_2577 [Bacteroides fragilis str. 1007-1-F #6] |
2.37e-17 | 81 | 82.609 | EXY13085 |
hypothetical protein M107_2089 [Bacteroides fragilis str. 3725 D9(v)] |
2.39e-17 | 81 | 82.609 | EXZ63739 |
hypothetical protein HMPREF2531_02168 [Bacteroides intestinalis] |
9.13e-13 | 96 | 76.364 | KXT51171 |
hypothetical protein BACCELL_04639 [Bacteroides cellulosilyticus DSM 14838] putative uncharacterized protein [Bacteroides cellulosilyticus CAG:158] Uncharacterised protein [uncultured Bacteroides sp.] |
3.23e-12 | 96 | 74.545 | EEF87758 |
hypothetical protein BACINT_02278 [Bacteroides intestinalis DSM 17393] uncharacterized protein BN711_00841 [Bacteroides intestinalis CAG:564] |
9.15e-12 | 96 | 74.545 | EDV03164 |
hypothetical protein HMPREF1212_02668 [Parabacteroides sp. HGS0025] hypothetical protein HMPREF1536_03734 [Parabacteroides gordonii MS-1] [Parabacteroides gordonii MS-1 = DSM 23371] |
1.31e-11 | 96 | 56.364 | KKB51930 |
hypothetical protein BcellWH2_00093 [Bacteroides cellulosilyticus] |
1.67e-11 | 96 | 72.727 | ALJ57369 |
succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides sp. 43_46] succinyl-CoA ligase [ADP-forming] subunit alpha [Bacteroides caccae CAG:21] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] |
1.92e-11 | 82 | 65.385 | WP_022042378 |
hypothetical protein HMPREF1076_03418 [Parabacteroides goldsteinii CL02T12C30] hypothetical protein C825_04337 [Parabacteroides sp. ASF519] hypothetical protein C803_00456 [Parabacteroides goldsteinii dnLKV18] hypothetical protein HMPREF1535_04131 [Parabacteroides goldsteinii DSM 19448 = WAL 12034] |
2.28e-11 | 96 | 58.182 | EKN12253 |
succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] |
2.67e-11 | 82 | 65.385 | WP_122364769 |
succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] |
3.54e-11 | 82 | 65.385 | WP_122118244 |
succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate-CoA ligase, alpha subunit [Bacteroides caccae ATCC 43185] succinate-CoA ligase, alpha subunit [Bacteroides caccae CL03T12C61] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] succinate--CoA ligase subunit alpha [Bacteroides caccae] |
3.72e-11 | 82 | 65.385 | WP_005675926 |
succinyl-CoA synthetase alpha chain [Bacteroides caccae] succinyl-CoA synthetase alpha chain [Bacteroides caccae] |
8.24e-11 | 82 | 65.385 | CUP18235 |
hypothetical protein PU94_08665 [Coprobacter secundus] |
1.65e-10 | 91 | 53.846 | KHM46955 |
succinate--CoA ligase subunit alpha, partial [Bacteroides caccae] |
3.29e-10 | 67 | 78.947 | KAA2321203 |
putative uncharacterized protein [Tannerella sp. CAG:118] |
6.94e-10 | 91 | 51.923 | CCY36072 |
hypothetical protein [Alistipes ihumii] |
3.18e-07 | 98 | 42.857 | WP_019245365 |
putative uncharacterized protein [Alistipes sp. CAG:157] |
2.26e-06 | 89 | 45.098 | CCZ99386 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_14 In bact CP040530.1
Seq (len = 57 ):
MSRRSQLEHEVSVAQERIKKAAKDTPKDIIKLWEQDLVDLELELNNLVDDEEDNNED
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|338414|-1|4553297-4553480
Transkriptom
82.0% of gene length expressed over median expression of contig.
ŝ
7.641633612724253
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
glyceraldehyde-3-phosphate dehydrogenase, partial [Rattus norvegicus]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
glyceraldehyde-3-phosphate dehydrogenase, partial [Rattus norvegicus] |
4.04e-17 | 100 | 100.000 | AAA41178 |
MULTISPECIES: aldehyde dehydrogenase [Escherichia] glyceraldehyde-3-phosphate dehydrogenase C GapC [Escherichia coli UMNK88] glyceraldehyde-3-phosphate dehydrogenase C (GAPDH-C), domain protein [Escherichia coli UMNF18] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli str. K-12 substr. MG1655] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli K-12] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli str. Sanji] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli str. K-12 substr. W3110] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli C] putative Glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli MS 196-1] putative Glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli MS 175-1] putative Glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli MS 116-1] putative Glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli MS 146-1] glyceraldehyde-3-phosphate dehydrogenase C (GAPDH-C) [Escherichia coli H736] hypothetical protein IAE_14697 [Escherichia coli XH140A] hypothetical protein IAM_16648 [Escherichia coli XH001] glyceraldehyde-3-phosphate dehydrogenase C domain protein [Escherichia coli STEC_EH250] glyceraldehyde-3-phosphate dehydrogenase C domain protein [Escherichia coli G58-1] glyceraldehyde-3-phosphate dehydrogenase C domain protein [Escherichia coli STEC_S1191] hypothetical protein ECDEC6A_1677 [Escherichia coli DEC6A] hypothetical protein ECDEC6B_1910 [Escherichia coli DEC6B] hypothetical protein ECDEC6C_1547 [Escherichia coli DEC6C] hypothetical protein ECDEC6D_1624 [Escherichia coli DEC6D] hypothetical protein ECDEC6E_1617 [Escherichia coli DEC6E] hypothetical protein ECDEC7B_1549 [Escherichia coli DEC7B] hypothetical protein OQE_23940 [Escherichia coli J53] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli O32:H37 str. P4] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli M919] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli H730] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia sp. 4_1_40B] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2.3916] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2.4168] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3.2303] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli B41] hypothetical protein EC75_14070 [Escherichia coli 75] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli TW15901] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli TW00353] hypothetical protein ECAD30_46490 [Escherichia coli AD30] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 8.0566] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 8.0569] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE44] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE51] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE56] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE77] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE81] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE111] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE156] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE161] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE171] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE42] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE154] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE197] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE120] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli S17] hypothetical protein C4893_12260 [Escherichia coli ONT:H33 str. C48/93] hypothetical protein C4390_18210 [Escherichia coli O127:H27 str. C43/90] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli MP021561.2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2722950] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 201600.1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2726950] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli BCE011_MS-01] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli P0299438.10] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli P0299438.4] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE35] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE14] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE34] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE40] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE198] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE61] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE130] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE132] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE155] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE41] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli HVH 164 (4-5953081)] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli HVH 209 (4-3062651)] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3139-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3174-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3180-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3329-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3318-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3592-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3609-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3889-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KOEGE 3 (4a)] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3150-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3151-1] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3271-1] hypothetical protein HMPREF1616_04570 [Escherichia coli 908658] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 39] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3148-1] hypothetical protein ECCZ_16354 [Escherichia coli ECC-Z] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-176-05_S1_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-176-05_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-110-08_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-110-08_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-110-08_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-110-08_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-110-08_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-176-05_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-250-04_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-250-04_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-176-05_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-392-07_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-176-05_S1_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-176-05_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-011-08_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-011-08_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-176-05_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-011-08_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-011-08_S1_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-052-05_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-105-05_S1_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-105-05_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-105-05_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-267-03_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-475-03_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-105-05_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S1_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S1_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-475-03_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S1_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-052-05_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-052-05_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-156-04_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-210-07_S1_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-392-07_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-005-03_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-210-07_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 1-392-07_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-177-06_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-210-07_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-222-05_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-316-03_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-316-03_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-427-07_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-460-02_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-460-02_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-460-02_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-460-02_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-460-02_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-474-04_S1_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-474-04_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-474-04_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-474-04_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-474-04_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-020-07_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-073-06_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-073-06_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-073-06_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-105-05_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-105-05_S1_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-460-02_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-020-07_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S1_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 4-203-08_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 3-373-03_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 5-172-05_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 5-172-05_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 5-172-05_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 5-172-05_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 5-172-05_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 6-175-07_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 6-175-07_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 6-175-07_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 7-233-03_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 7-233-03_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 6-537-08_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 7-233-03_S1_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 7-233-03_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 8-415-05_S1_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 7-233-03_S4_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 7-233-03_S4_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 6-537-08_S4_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-052-05_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-222-05_S3_C1] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-222-05_S3_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 8-415-05_S1_C2] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-177-06_S3_C3] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 5-366-08_S4_C1] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli NCTC 50110] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli VL2732] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli VL2874] glyceraldehyde-3-phosphate dehydrogenase C (GAPDH-C) [Escherichia coli TA144] glyceraldehyde-3-phosphate dehydrogenase C (GAPDH-C) [Escherichia coli H617] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli M4] aldehyde dehydrogenase [Shigella boydii] aldehyde dehydrogenase [Shigella sonnei] aldehyde dehydrogenase [Shigella flexneri] NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli O10:K5(L):H4 str. ATCC 23506] NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli IS25] hypothetical protein KRX_1345 [Escherichia coli KRX] NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Klebsiella pneumoniae] aldehyde dehydrogenase [Shigella sp.] |
6.58e-17 | 100 | 100.000 | WP_000048641 |
glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating), partial [Rattus rattus] |
1.04e-16 | 100 | 100.000 | CAA38569 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.08e-16 | 100 | 97.368 | ASO00445 |
aldehyde dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3317-1] glyceraldehyde-3-phosphate dehydrogenase C GapC [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C GapC [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C GapC [Escherichia coli] |
1.08e-16 | 100 | 97.368 | WP_021570473 |
aldehyde dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.62e-16 | 100 | 97.368 | WP_095140368 |
hypothetical protein DS961_20235 [Escherichia coli] |
2.66e-16 | 100 | 97.368 | RBY51821 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.69e-16 | 100 | 97.368 | STI95948 |
hypothetical protein [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.74e-16 | 100 | 97.368 | WP_053919832 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.87e-16 | 100 | 97.368 | KHD50993 |
glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
3.58e-16 | 100 | 97.368 | KIH27799 |
glyceraldehyde-3-phosphate dehydrogenase C GapC [Escherichia coli] |
3.65e-16 | 100 | 97.368 | STL65607 |
hypothetical protein BE930_06720 [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 19C] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 43b] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 43a] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 19B] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 19A] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 17B] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 17A] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 15] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 9] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 3] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 2B] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 6] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 82] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli BIDMC 71] Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Escherichia coli PCN079] NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli IS5] NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Klebsiella oxytoca] |
5.14e-16 | 100 | 94.737 | AQV66577 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.31e-16 | 100 | 97.368 | PAB89470 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
5.4e-16 | 100 | 97.368 | GCG25082 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
5.45e-16 | 100 | 97.368 | GCX25755 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
6.02e-16 | 100 | 97.368 | SPW59352 |
hypothetical protein D1889_10905 [Escherichia coli] hypothetical protein D1904_15735 [Escherichia coli] |
6.13e-16 | 100 | 97.368 | RIC54333 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
7.03e-16 | 100 | 97.368 | KXL25846 |
aldehyde dehydrogenase, partial [Escherichia coli] |
7.78e-16 | 100 | 97.368 | WP_139431910 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
8.1e-16 | 100 | 97.368 | MWM21151 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE194] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE113] |
8.48e-16 | 100 | 97.368 | ELH15252 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
8.54e-16 | 100 | 97.368 | STP20099 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
8.71e-16 | 100 | 97.368 | ORS49521 |
aldehyde dehydrogenase, partial [Escherichia coli] |
8.82e-16 | 100 | 97.368 | WP_139499682 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
9.28e-16 | 100 | 97.368 | MQK39911 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella flexneri] |
9.92e-16 | 100 | 97.368 | PQN14013 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.01e-15 | 100 | 97.368 | MXI78543 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.04e-15 | 100 | 97.368 | EAA0859523 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.13e-15 | 100 | 97.368 | VEA82363 |
glyceraldehyde-3-phosphate dehydrogenase C domain protein [Escherichia coli 3431] glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli KTE71] glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 2-210-07_S3_C3] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.21e-15 | 100 | 97.368 | EFU99851 |
Glyceraldehyde 3-phosphate dehydrogenase [Shigella dysenteriae 1617] Glyceraldehyde 3-phosphate dehydrogenase [Shigella dysenteriae WRSd3] Glyceraldehyde 3-phosphate dehydrogenase [Shigella dysenteriae WRSd5] hypothetical protein A0V00_19735 [Shigella dysenteriae] glyceraldehyde-3-phosphate dehydrogenase C [Shigella dysenteriae 1617] |
1.22e-15 | 100 | 97.368 | AHA65184 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.23e-15 | 100 | 97.368 | SQD03658 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Enterobacteriaceae bacterium TzEc052] |
1.3e-15 | 100 | 97.368 | KAE9892112 |
hypothetical protein CRG93_13180 [Escherichia sp. E2593] |
1.37e-15 | 100 | 94.737 | TGC08275 |
glyceraldehyde-3-phosphate dehydrogenase C [Citrobacter koseri] |
1.47e-15 | 100 | 92.105 | SQB39847 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli UMEA 3206-1] |
1.53e-15 | 100 | 97.368 | EQY03475 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.54e-15 | 100 | 97.368 | CTT48815 |
hypothetical protein [Escherichia coli] |
1.7e-15 | 100 | 97.368 | WP_113383297 |
PUTATIVE PSEUDOGENE: RecName: Full=Putative glyceraldehyde-3-phosphate dehydrogenase C; Short=GAPDH-C; AltName: Full=NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli K-12] |
1.7e-15 | 100 | 100.000 | P33898 |
hypothetical protein CMV47_13515 [Escherichia coli] |
1.74e-15 | 100 | 97.368 | RJK45078 |
hypothetical protein, partial [Shigella sonnei] |
1.82e-15 | 100 | 97.368 | WP_072115560 |
glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
2.14e-15 | 100 | 97.368 | SIZ33902 |
hypothetical protein BCV59_00735 [Escherichia coli] hypothetical protein CFSAN004177_25855 [Escherichia coli] |
2.16e-15 | 100 | 97.368 | AOM53165 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
2.26e-15 | 100 | 97.368 | GCI19622 |
NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli IS1] |
2.28e-15 | 100 | 94.737 | CDK46852 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.31e-15 | 100 | 97.368 | SPW39168 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.34e-15 | 100 | 97.368 | MGJ36046 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.35e-15 | 100 | 97.368 | MSL22749 |
glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] |
2.51e-15 | 100 | 97.368 | WP_072118697 |
glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain protein [Escherichia coli 180050] |
2.68e-15 | 100 | 97.368 | EMW89080 |
NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli IS35] |
2.74e-15 | 100 | 97.368 | CDL03613 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.85e-15 | 100 | 97.368 | VEC56769 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
2.88e-15 | 100 | 97.368 | STG09567 |
hypothetical protein AVR73_09010 [Escherichia coli] |
2.93e-15 | 100 | 97.368 | ALX62449 |
glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
3.45e-15 | 100 | 97.368 | EAA0626965 |
glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
3.5e-15 | 100 | 97.368 | EAA1902380 |
hypothetical protein AWP60_16865 [Escherichia coli] |
3.87e-15 | 100 | 97.368 | OKV74553 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
3.92e-15 | 100 | 97.368 | TVS74647 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella boydii] |
3.96e-15 | 100 | 97.368 | RIF73306 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
4.1e-15 | 100 | 94.737 | MSF26647 |
type I glyceraldehyde-3-phosphate dehydrogenase [Bacillus thuringiensis] |
4.21e-15 | 100 | 89.474 | MRB85038 |
hypothetical protein ACM17_08540 [Escherichia coli] |
4.72e-15 | 100 | 97.368 | KMV47887 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
4.91e-15 | 100 | 97.368 | MSL38364 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella flexneri] |
5.03e-15 | 100 | 97.368 | EAA3475610 |
glyceraldehyde-3-phosphate dehydrogenase C domain protein [Shigella boydii 5216-82] |
5.19e-15 | 100 | 97.368 | EGI96347 |
glyceraldehyde-3-phosphate dehydrogenase C [Escherichia coli] |
5.29e-15 | 100 | 97.368 | GCT50066 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
5.61e-15 | 100 | 97.368 | STF86855 |
glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
6.18e-15 | 100 | 97.368 | OMH06094 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
9.6e-15 | 100 | 97.368 | WP_063091319 |
aldehyde dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase c [Escherichia coli LF82] |
1.09e-14 | 100 | 97.368 | WP_000048686 |
glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.11e-14 | 100 | 97.368 | WP_044076810 |
glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.11e-14 | 100 | 97.368 | WP_042095950 |
NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli ISC11] |
1.17e-14 | 100 | 89.474 | CDL40420 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.18e-14 | 100 | 97.368 | CTT51246 |
glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
1.22e-14 | 100 | 97.368 | SJE22992 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.28e-14 | 100 | 97.368 | WP_097495955 |
glyceraldehyde-3-phosphate dehydrogenase, partial [Escherichia coli] |
1.29e-14 | 100 | 97.368 | WP_000048657 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase, type I [Shigella sonnei 3226-85] glyceraldehyde-3-phosphate dehydrogenase, type I [Shigella sonnei 3233-85] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
1.31e-14 | 100 | 97.368 | WP_005146409 |
aldehyde dehydrogenase, partial [Escherichia coli] |
1.31e-14 | 100 | 97.368 | WP_151240145 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
1.32e-14 | 100 | 97.368 | WP_072107410 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli O26:H11 str. CVM9952] |
1.33e-14 | 100 | 97.368 | EJE93380 |
glyceraldehyde-3-phosphate dehydrogenase [Shigella flexneri K-404] |
1.34e-14 | 100 | 97.368 | EIQ29380 |
glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
1.39e-14 | 100 | 97.368 | CSO57998 |
glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.41e-14 | 100 | 97.368 | CTT82401 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
1.42e-14 | 100 | 97.368 | WP_072110286 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] glyceraldehyde-3-phosphate dehydrogenase, type I [Shigella sonnei str. Moseley] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella sonnei] |
1.42e-14 | 100 | 97.368 | WP_000048666 |
type I glyceraldehyde-3-phosphate dehydrogenase [Shigella flexneri] type I glyceraldehyde-3-phosphate dehydrogenase [Shigella flexneri] |
1.48e-14 | 100 | 97.368 | WP_146761496 |
hypothetical protein EAOG_00659 [Escherichia coli R527] |
1.52e-14 | 100 | 97.368 | OSK11548 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.68e-14 | 100 | 97.368 | WP_053275973 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.68e-14 | 100 | 97.368 | WP_103722162 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.68e-14 | 100 | 97.368 | WP_112922626 |
type I glyceraldehyde-3-phosphate dehydrogenase, partial [Shigella sonnei] |
1.73e-14 | 100 | 97.368 | WP_052942038 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.73e-14 | 100 | 97.368 | WP_096184938 |
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain protein [Escherichia coli 2741950] |
1.79e-14 | 100 | 97.368 | ENA82734 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.8e-14 | 100 | 97.368 | WP_054496209 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.8e-14 | 100 | 97.368 | MHZ41897 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.8e-14 | 100 | 97.368 | MHX14826 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] Glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] |
1.8e-14 | 100 | 97.368 | WP_115440636 |
type I glyceraldehyde-3-phosphate dehydrogenase [Escherichia coli] glyceraldehyde-3-phosphate dehydrogenase, type I [Escherichia coli B367] |
1.8e-14 | 100 | 97.368 | WP_085458711 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_15 In bifi AE014295.3
Seq (len = 174 ):
VVADLVEHDVTDVTPGKDPATVERFARDFMGHNGVPEYVRLVSCDMSLGFRKGIRECLPNVRRIVDKFHVARHANEAVDKAGKTEGRSNPLLKRTKYLWLRNEESLAELQLETKRNLTRQRLRTGRACRMREVPQDVYADSPTPSEAWVRLHRLCSSVFRQVGVSCLVMYFFRV
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|40726|1|1841183-1842311
Transkriptom
10.0% of gene length expressed over median expression of contig.
ŝ
4.323306390375134
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Transposase [Bifidobacterium longum subsp. infantis]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Transposase [Bifidobacterium longum subsp. infantis] |
1.41e-108 | 90 | 98.077 | VUX31717 |
transposase [Bifidobacterium longum subsp. longum] |
5.87e-100 | 90 | 90.385 | TCF69300 |
transposase [Bifidobacterium longum subsp. longum] |
3.1e-99 | 90 | 90.385 | TCF19861 |
transposase [Bifidobacterium longum subsp. longum] |
7.69e-99 | 90 | 89.744 | TCE34844 |
transposase [Bifidobacterium longum subsp. longum GT15] |
1.33e-98 | 90 | 90.385 | AIW44939 |
ISL3 family transposase [Bifidobacterium longum subsp. suis] ISL3 family transposase [Bifidobacterium longum subsp. suis] |
1.48e-98 | 90 | 89.744 | OIN62544 |
Transposase-like protein [Bifidobacterium longum subsp. longum JDM301] transposase [Bifidobacterium longum] |
1.62e-98 | 90 | 89.744 | ADH01226 |
transposase [Bifidobacterium longum subsp. longum] |
1.88e-98 | 90 | 89.744 | TCD72342 |
ISL3 family transposase, partial [Bifidobacterium longum] |
2.02e-98 | 90 | 89.744 | WP_131206673 |
transposase [Bifidobacterium longum subsp. longum] |
2.79e-98 | 90 | 89.744 | TCF49818 |
transposase [Bifidobacterium longum subsp. longum] |
5.06e-98 | 90 | 89.744 | TCE71798 |
transposase [Bifidobacterium longum subsp. longum 1-5B] transposase [Bifidobacterium longum subsp. longum 72B] transposase [Bifidobacterium longum subsp. longum EK13] transposase [Bifidobacterium longum] |
6.52e-98 | 90 | 90.385 | KEY25356 |
transposase [Bifidobacterium longum] |
6.84e-98 | 90 | 89.744 | KYJ81430 |
ISL3 family transposase [Bifidobacterium longum subsp. suis] |
7.69e-98 | 90 | 89.744 | OIN64825 |
ISL3 family transposase, partial [Bifidobacterium longum] |
9.57e-98 | 90 | 89.744 | WP_081356155 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
9.67e-98 | 90 | 90.385 | TCE49837 |
transposase [Bifidobacterium longum subsp. longum] |
9.88e-98 | 90 | 90.385 | TCE16278 |
transposase [Bifidobacterium longum subsp. longum KACC 91563] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
1.13e-97 | 90 | 90.385 | AEI96584 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
1.15e-97 | 90 | 90.385 | TCE20182 |
transposase [Bifidobacterium longum subsp. longum] |
2.19e-97 | 90 | 89.744 | TCD91644 |
transposase [Bifidobacterium longum subsp. longum] |
3.01e-97 | 90 | 89.744 | TCD82153 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum] Transposase and inactivated derivatives [Bifidobacterium longum subsp. longum F8] transposase [Bifidobacterium longum] transposase [Bifidobacterium longum] |
3.4e-97 | 90 | 89.744 | ALO73459 |
transposase [Bifidobacterium longum subsp. longum] |
3.51e-97 | 90 | 89.744 | TCD95251 |
transposase [Bifidobacterium longum subsp. longum] |
3.67e-97 | 90 | 89.744 | TCE22463 |
transposase [Bifidobacterium longum] |
3.91e-97 | 90 | 89.744 | PKC97294 |
transposase [Bifidobacterium longum subsp. infantis 157F] |
4.76e-97 | 90 | 89.744 | BAJ72052 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
4.98e-97 | 90 | 89.744 | TCD76666 |
transposase [Bifidobacterium longum subsp. longum] |
5.37e-97 | 90 | 89.744 | TCE54593 |
transposase [Bifidobacterium longum subsp. suis] |
5.84e-97 | 90 | 89.744 | KFI67089 |
transposase [Bifidobacterium longum] transposase [Bifidobacterium longum] |
5.93e-97 | 90 | 89.744 | PKD04704 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
1.2e-96 | 90 | 89.103 | TCD90971 |
ISL3 family transposase, partial [Bifidobacterium longum] ISL3 family transposase, partial [Bifidobacterium longum] ISL3 family transposase, partial [Bifidobacterium longum] ISL3 family transposase, partial [Bifidobacterium longum] ISL3 family transposase, partial [Bifidobacterium longum] |
2.29e-96 | 90 | 89.744 | KAB6881751 |
transposase [Bifidobacterium longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
2.37e-96 | 90 | 89.103 | OQM71321 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
2.4e-96 | 90 | 89.103 | TCD84076 |
ISL3-like element ISBlo6 family transposase, partial [Bifidobacterium longum] |
2.49e-96 | 90 | 89.744 | WP_131221038 |
transposase [Bifidobacterium longum subsp. longum] |
4.14e-96 | 90 | 89.103 | TCD80374 |
transposase [Bifidobacterium longum subsp. longum] |
6.42e-96 | 90 | 88.462 | TCF13087 |
ISL3 family transposase [Bifidobacterium longum] |
9.33e-95 | 90 | 89.744 | WP_144169313 |
transposase [Bifidobacterium longum subsp. longum] |
1.51e-94 | 90 | 87.179 | TCF40722 |
ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum] |
3.52e-94 | 90 | 89.103 | WP_115770518 |
ISL3 family transposase [Bifidobacterium sp. WCA-178-WT-4B] ISL3 family transposase [Bifidobacterium sp. WCA-178-WT-4B] |
7.46e-91 | 93 | 84.472 | WP_154536573 |
ISL3 family transposase [Bifidobacterium longum subsp. infantis] |
1.95e-87 | 90 | 82.692 | OIN63603 |
ISL3 family transposase [Bifidobacterium longum subsp. infantis] |
2e-87 | 90 | 82.692 | OIN64156 |
ISL3 family transposase [Bifidobacterium breve] transposase [Bifidobacterium breve] |
5.2e-87 | 93 | 80.745 | WP_080988182 |
ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum subsp. infantis] |
9.15e-87 | 90 | 83.974 | WP_136500698 |
ISL3 family transposase, partial [Bifidobacterium longum] |
2.11e-86 | 90 | 83.333 | WP_081292591 |
ISL3 family transposase, partial [Bifidobacterium longum] |
9.03e-86 | 90 | 83.333 | WP_081292610 |
ISL3 family transposase, partial [Bifidobacterium longum] |
1.05e-85 | 90 | 83.333 | WP_081292659 |
ISL3 family transposase, partial [Bifidobacterium longum] |
1.67e-85 | 90 | 82.692 | WP_144133516 |
transposase [Bifidobacterium longum subsp. longum] |
5.89e-84 | 90 | 80.128 | TCE10638 |
ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum subsp. infantis] |
3.8e-83 | 90 | 81.410 | WP_136501110 |
ISL3 family transposase [Bifidobacterium longum] |
4.05e-83 | 90 | 81.410 | WP_143725048 |
ISL3 family transposase, partial [Bifidobacterium callitrichos] transposase, partial [Bifidobacterium callitrichos DSM 23973] |
1.81e-81 | 90 | 76.923 | WP_052401183 |
ISL3 family transposase, partial [Bifidobacterium reuteri] |
8.25e-81 | 90 | 75.641 | WP_052404695 |
ISL3 family transposase [Bifidobacterium sp. WCA-178-WT-4B] ISL3 family transposase [Bifidobacterium sp. WCA-178-WT-4B] |
2.91e-80 | 90 | 79.487 | WP_154536762 |
transposase [Bifidobacterium sp. UTCIF-38] |
6.93e-79 | 90 | 76.282 | TPF86994 |
ISL3 family transposase, partial [Bifidobacterium sp. UTCIF-37] transposase, partial [Bifidobacterium sp. UTCIF-37] |
7.48e-79 | 90 | 76.282 | WP_140445873 |
ISL3 family transposase, partial [Bifidobacterium sp. UTCIF-38] |
3.31e-78 | 90 | 76.282 | WP_140476381 |
transposase [Bifidobacterium callitrichos DSM 23973] |
9.86e-78 | 90 | 76.923 | KFI56510 |
ISL3 family transposase, partial [Bifidobacterium callitrichos] |
1.83e-77 | 90 | 75.641 | WP_081887189 |
ISL3 family transposase [Bifidobacterium callitrichos] ISL3 family transposase [Bifidobacterium callitrichos] |
1.96e-77 | 90 | 76.282 | WP_107044973 |
ISL3 family transposase [Bifidobacterium callitrichos] ISL3 family transposase [Bifidobacterium callitrichos] |
2.65e-77 | 90 | 76.282 | WP_150394851 |
ISL3 family transposase [Bifidobacterium reuteri] transposase [Bifidobacterium reuteri DSM 23975] |
2.77e-77 | 90 | 76.282 | WP_081886676 |
MULTISPECIES: ISL3 family transposase [Bifidobacterium] ISL3 family transposase [Bifidobacterium reuteri] transposase [Bifidobacterium reuteri DSM 23975] transposase [Bifidobacterium sp. UTBIF-68] |
5.14e-77 | 90 | 75.641 | WP_081886587 |
ISL3 family transposase [Bifidobacterium breve] Transposase [Bifidobacterium breve] |
3.32e-76 | 90 | 75.000 | WP_143246096 |
ISL3 family transposase, partial [Bifidobacterium longum] |
1.89e-74 | 80 | 82.143 | WP_144099242 |
ISL3 family transposase [Bifidobacterium longum] |
4.3e-74 | 90 | 73.718 | WP_143723114 |
transposase [Bifidobacterium longum subsp. longum] |
1.18e-72 | 76 | 83.459 | TCF48319 |
ISL3 family transposase [Bifidobacterium subtile] transposase [Bifidobacterium subtile] |
1.83e-72 | 92 | 70.000 | WP_024463771 |
hypothetical protein [Bifidobacterium breve] |
1.25e-68 | 90 | 66.026 | WP_134858467 |
hypothetical protein [Bifidobacterium breve] |
1.58e-68 | 90 | 66.026 | WP_081293818 |
Uncharacterised protein [Bifidobacterium longum subsp. infantis] |
2.16e-68 | 90 | 66.026 | VUW83127 |
ISL3 family transposase, partial [Bifidobacterium breve] |
2.35e-68 | 90 | 66.026 | RDX27019 |
ISL3 family transposase, partial [Bifidobacterium longum] |
5.36e-68 | 92 | 67.500 | WP_131262416 |
transposase [Bifidobacterium longum subsp. longum] |
1.1e-67 | 92 | 67.500 | KUP19436 |
transposase [Bifidobacterium longum subsp. longum] |
2.18e-67 | 90 | 66.026 | TCE57513 |
transposase [Bifidobacterium longum subsp. longum EK13] |
5.38e-67 | 92 | 67.500 | KEY32979 |
ISL3 family transposase, partial [Bifidobacterium longum] transposase, partial [Bifidobacterium longum] |
1.07e-66 | 92 | 66.875 | WP_143248476 |
ISL3 family transposase, partial [Bifidobacterium longum] transposase, partial [Bifidobacterium longum] |
2.7e-66 | 92 | 66.250 | WP_143248458 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
2.96e-66 | 92 | 67.500 | TCE19754 |
transposase [Bifidobacterium longum subsp. longum] |
3.91e-65 | 92 | 67.500 | OLR95850 |
ISL3 family transposase, partial [Bifidobacterium longum] |
4.31e-65 | 92 | 67.500 | WP_138290606 |
ISL3 family transposase, partial [Bifidobacterium longum] ISL3 family transposase, partial [Bifidobacterium longum] |
4.65e-65 | 92 | 67.500 | WP_109088126 |
transposase [Bifidobacterium pullorum] |
5.38e-65 | 92 | 67.500 | KFI80887 |
ISL3 family transposase [Bifidobacterium longum] transposase [Bifidobacterium longum] |
5.97e-65 | 92 | 67.500 | WP_080824313 |
ISL3 family transposase, partial [Escherichia coli] ISL3 family transposase [Escherichia coli] |
7.39e-65 | 92 | 67.500 | WP_154312677 |
ISL3 family transposase [Bifidobacterium longum] transposase [Bifidobacterium longum subsp. longum] ISL3 family transposase [Bifidobacterium longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
7.49e-65 | 92 | 67.500 | WP_065444277 |
ISL3 family transposase [Streptococcus parasanguinis] ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum] |
7.57e-65 | 92 | 67.500 | WP_155164883 |
ISL3 family transposase [Bifidobacterium longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
7.73e-65 | 92 | 67.500 | WP_131219154 |
ISL3 family transposase [Bifidobacterium longum] transposase [Bifidobacterium longum subsp. longum] |
7.73e-65 | 92 | 67.500 | WP_131203799 |
ISL3 family transposase [Bifidobacterium longum] |
8.52e-65 | 92 | 67.500 | WP_080715004 |
MULTISPECIES: ISL3 family transposase [Bifidobacterium] transposase [Bifidobacterium saguini DSM 23967] ISL3 family transposase [Escherichia coli] transposase [Bifidobacterium longum subsp. longum] ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum] |
8.52e-65 | 92 | 67.500 | WP_065445495 |
transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] transposase [Bifidobacterium longum subsp. longum] |
1.23e-64 | 92 | 66.250 | TCE03032 |
ISL3 family transposase [Bifidobacterium gallinarum] transposase [Bifidobacterium gallinarum] |
1.91e-64 | 92 | 66.875 | WP_081929630 |
ISL3 family transposase [Bifidobacterium longum] ISL3 family transposase [Bifidobacterium longum subsp. suis] |
1.06e-63 | 92 | 66.875 | WP_071474811 |
ISL3 family transposase [Bifidobacterium gallinarum] ISL3 family transposase [Bifidobacterium gallinarum] |
2.03e-63 | 92 | 66.250 | WP_129237903 |
ISL3 family transposase [Bifidobacterium longum] transposase [Bifidobacterium longum] |
3.06e-63 | 92 | 66.250 | WP_080826717 |
ISL3 family transposase [Bifidobacterium sp.] |
3.7e-62 | 90 | 64.744 | HCH22577 |
transposase, ISL3 family [Bifidobacterium aquikefiri] |
4.48e-62 | 90 | 64.744 | OZG67637 |
ISL3 family transposase, partial [Escherichia coli] ISL3 family transposase [Escherichia coli] |
5.53e-62 | 92 | 65.625 | WP_154305493 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_16 In ecoli U00096.3
Seq (len = 337 ):
MSAQAAEIYNKDSNKLDLYGKVNAKHYFSSNDADDGDTTYARLGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAGLKFGDYGSIDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTQRATGVATYRNNDFFGLVDGLNFAAQYQGKNDRSDFDNYTEGNGDGFGFSATYEYEGFGIGATYAKSDRTDTQVNAGKVLPEVFASGKNAEVWAAGLKYDANNIYLATTYSETQNMTVFADHFVANKAQNFEAVAQYQFDFGLRPSVAYLQSKGKDLGVWGDQDLVKYVDVGATYYFNKNMSTFVDYKINLLDKNDFTKEGANKSLI
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|318421|-1|575760-576885
Transkriptom
75.0% of gene length expressed over median expression of contig.
ŝ
6.232596743149578
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
porin [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
outer membrane porin protein [Escherichia coli] outer membrane porin; DLP12 prophage, partial [Escherichia coli XH001] outer membrane porin protein NmpC [Escherichia coli J53] Prophage protein, Putative membrane porin [Escherichia coli] Prophage protein, Putative membrane porin [Escherichia coli] |
0.0 | 100 | 100.000 | AAB40749 |
porin [Escherichia coli] porin [Escherichia coli KLY] porin [Escherichia coli str. K-12 substr. MG1655] porin [Escherichia coli K-12] phosphoporin PhoE [Escherichia coli str. K-12 substr. W3110] porin [Escherichia coli BW25113] porin [Escherichia coli O16:H48] porin [Escherichia coli HT115] |
0.0 | 100 | 100.000 | WP_000737282 |
outer membrane porin; DLP12 prophage, partial [Escherichia coli XH140A] |
0.0 | 99 | 100.000 | EGU24952 |
nmpC [Escherichia coli] |
0.0 | 100 | 99.703 | AAA23728 |
porin, partial [Escherichia coli] |
0.0 | 99 | 100.000 | WP_000737281 |
porin, partial [Escherichia coli] phosphoporin PhoE, partial [Escherichia coli] |
0.0 | 99 | 100.000 | WP_053265403 |
outer membrane porin protein, partial [Escherichia coli NCTC 50110] |
0.0 | 99 | 100.000 | KGL67704 |
outer membrane porin; DLP12 prophage [Escherichia coli] |
0.0 | 99 | 99.401 | VDG56231 |
porin, partial [Escherichia coli] phosphoporin PhoE, partial [Escherichia coli] phosphoporin PhoE, partial [Escherichia coli] |
0.0 | 99 | 100.000 | WP_047414052 |
porin, partial [Escherichia coli] phosphoporin PhoE, partial [Escherichia coli] |
0.0 | 99 | 100.000 | WP_095476871 |
porin OmpC [Escherichia coli] porin [Escherichia coli] |
0.0 | 100 | 99.110 | WP_138817834 |
porin OmpC [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 99.697 | WP_138795914 |
porin, partial [Escherichia coli] |
0.0 | 98 | 100.000 | WP_072338383 |
outer membrane porin protein NmpC [Escherichia coli M718] outer membrane porin protein LC [Escherichia coli B41] |
0.0 | 98 | 100.000 | EGI22851 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli 2-011-08_S3_C3] outer membrane porin protein ompD [Escherichia coli 2-011-08_S3_C1] outer membrane porin protein ompD [Escherichia coli 7-233-03_S3_C1] outer membrane porin protein ompD [Escherichia coli 7-233-03_S3_C3] porin [Escherichia coli] |
0.0 | 98 | 100.000 | WP_032178961 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] outer membrane porin protein [Escherichia coli] |
0.0 | 98 | 100.000 | WP_057081093 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli 2-210-07_S3_C2] |
0.0 | 98 | 100.000 | WP_032262540 |
MULTISPECIES: porin [Enterobacteriaceae] PUTATIVE PSEUDOGENE: RecName: Full=Putative outer membrane porin protein NmpC; Flags: Precursor [Escherichia coli K-12] outer membrane porin protein NmpC [Escherichia coli H299] outer membrane porin protein [Escherichia coli SEPT362] outer membrane porin protein ompD [Escherichia coli 2785200] outer membrane porin OmpD [Escherichia coli HVH 79 (4-2512823)] outer membrane porin OmpD [Escherichia coli HVH 151 (4-5755573)] outer membrane porin protein ompD [Escherichia coli 1-110-08_S1_C3] outer membrane porin protein ompD [Escherichia coli 1-110-08_S1_C1] outer membrane porin protein ompD [Escherichia coli 2-052-05_S3_C1] outer membrane porin protein ompD [Escherichia coli 2-052-05_S3_C3] outer membrane porin protein ompD [Escherichia coli 2-156-04_S1_C3] outer membrane porin protein ompD [Escherichia coli 2-210-07_S3_C1] outer membrane porin protein ompD [Escherichia coli 2-316-03_S3_C1] outer membrane porin protein ompD [Escherichia coli 2-427-07_S1_C3] outer membrane porin protein ompD [Escherichia coli 5-172-05_S1_C3] outer membrane porin protein ompD [Escherichia coli 2-052-05_S3_C2] porin [Escherichia coli O1:H42] outer membrane porin protein [Escherichia coli ETEC H10407] |
0.0 | 98 | 100.000 | WP_000737280 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli 2-210-07_S1_C3] outer membrane porin protein ompD [Escherichia coli 2-210-07_S1_C2] porin [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] |
0.0 | 98 | 99.696 | WP_032248293 |
porin [Escherichia coli] |
0.0 | 98 | 99.696 | WP_106661712 |
porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 99.696 | WP_134250862 |
outer membrane porin protein LC [Escherichia coli 2.3916] |
0.0 | 98 | 99.696 | EII48100 |
porin [Escherichia coli] outer membrane porin protein [Escherichia coli] |
0.0 | 98 | 99.696 | WP_137472049 |
porin [Escherichia coli] |
0.0 | 98 | 99.696 | WP_000737256 |
porin [Salmonella enterica subsp. enterica serovar Montevideo] |
0.0 | 98 | 99.696 | ECN2761307 |
porin [Escherichia coli] |
0.0 | 98 | 99.696 | WP_109866416 |
porin [Escherichia coli] |
0.0 | 98 | 99.696 | WP_096954100 |
porin [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] |
0.0 | 97 | 100.000 | WP_111970252 |
MULTISPECIES: porin [Escherichia] porin [Escherichia coli] porin [Escherichia coli] phosphoporin PhoE [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] |
0.0 | 97 | 100.000 | WP_059252017 |
porin [Escherichia coli] |
0.0 | 98 | 99.696 | WP_097436202 |
porin [Escherichia coli] outer membrane porin protein LC [Escherichia coli UMNF18] |
0.0 | 98 | 99.696 | WP_000737255 |
porin, partial [Escherichia coli] porin OmpC, partial [Escherichia coli] porin OmpC, partial [Escherichia coli] porin OmpC, partial [Escherichia coli] porin OmpC, partial [Escherichia coli] porin OmpC, partial [Escherichia coli] |
0.0 | 97 | 100.000 | WP_047666238 |
porin [Escherichia coli] |
0.0 | 98 | 99.696 | WP_097413682 |
porin [Escherichia coli] |
0.0 | 98 | 99.696 | MIA39111 |
porin OmpD [Escherichia coli] |
0.0 | 98 | 100.000 | WP_115903963 |
gram-negative porin [Escherichia coli E1520] |
0.0 | 98 | 99.392 | EGB34761 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpD [Escherichia coli] |
0.0 | 98 | 100.000 | WP_134884956 |
porin [Escherichia coli] phosphoporin PhoE [Escherichia coli] |
0.0 | 98 | 99.696 | WP_098712883 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_097484801 |
Outer membrane porin protein NmpC precursor [Escherichia coli CE516] |
0.0 | 98 | 99.392 | ESS89391 |
porin OmpC [Escherichia coli] |
0.0 | 98 | 99.392 | WP_139505552 |
porin [Salmonella enterica] |
0.0 | 97 | 99.695 | EAY9556510 |
porin [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] |
0.0 | 97 | 99.695 | WP_112868052 |
porin [Escherichia coli] porin OmpC [Escherichia coli] phosphoporin PhoE [Escherichia coli] |
0.0 | 98 | 99.392 | WP_071701674 |
porin, partial [Escherichia coli] outer membrane porin protein ompD, partial [Escherichia coli 180200] |
0.0 | 98 | 99.392 | WP_001389875 |
porin [Escherichia coli] |
0.0 | 98 | 99.392 | WP_097755118 |
porin [Escherichia coli] |
0.0 | 98 | 99.392 | WP_064753377 |
porin [Escherichia coli] porin OmpC [Shigella sonnei] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 99.392 | WP_000737267 |
porin, partial [Escherichia coli] phosphoporin PhoE, partial [Escherichia coli] phosphoporin PhoE, partial [Escherichia coli] |
0.0 | 98 | 99.392 | WP_074522945 |
porin, partial [Escherichia coli] outer membrane porin protein ompD, partial [Escherichia coli 178200] |
0.0 | 98 | 99.392 | WP_001361498 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] phosphoporin PhoE [Escherichia coli] phosphoporin PhoE [Escherichia coli] phosphoporin PhoE [Escherichia coli] |
0.0 | 97 | 99.695 | WP_072646336 |
MULTISPECIES: porin [Enterobacteriaceae] outer membrane porin protein [Escherichia coli ECC-1470] phosphoporin PhoE [Escherichia coli M8] outer membrane porin protein LC [Escherichia coli MS 84-1] outer membrane porin protein LC [Escherichia coli MS 124-1] outer membrane porin protein LC [Escherichia coli MS 85-1] outer membrane porin protein LC [Escherichia coli STEC_7v] outer membrane porin protein LC [Escherichia coli STEC_94C] outer membrane porin protein ompD [Escherichia coli DEC9E] outer membrane porin protein ompD [Escherichia coli DEC10E] outer membrane porin protein ompD [Escherichia coli DEC14B] outer membrane porin protein ompD [Escherichia coli DEC14C] outer membrane porin protein ompD [Escherichia coli DEC14D] prophage outer membrane porin [Escherichia coli O32:H37 str. P4] outer membrane porin protein LC [Escherichia coli 5.0588] outer membrane porin protein LC [Escherichia coli 3.3884] outer membrane porin protein LC [Escherichia coli N1] outer membrane porin protein LC [Escherichia coli KTE12] outer membrane porin protein LC [Escherichia coli KTE48] outer membrane porin protein LC [Escherichia coli KTE91] outer membrane porin protein LC [Escherichia coli KTE136] outer membrane porin protein LC [Escherichia coli KTE184] outer membrane porin protein LC [Escherichia coli KTE203] outer membrane porin protein LC [Escherichia coli KTE166] outer membrane porin protein LC [Escherichia coli KTE90] outer membrane porin protein ompD [Escherichia coli 2872800] outer membrane porin protein ompD [Escherichia coli 2867750] outer membrane porin protein ompD [Escherichia coli 2866550] outer membrane porin protein ompD [Escherichia coli 2866450] outer membrane porin protein ompD [Escherichia coli 2866750] outer membrane porin protein ompD [Escherichia coli 2851500] outer membrane porin protein ompD [Escherichia coli 2853500] outer membrane porin protein ompD [Escherichia coli 2850750] outer membrane porin protein ompD [Escherichia coli 2850400] outer membrane porin protein ompD [Escherichia coli 2756500] outer membrane porin protein ompD [Escherichia coli 180600] outer membrane porin protein ompD [Escherichia coli 180050] outer membrane porin protein ompD [Escherichia coli P0304777.1] outer membrane porin protein ompD [Escherichia coli P0302308.1] outer membrane porin protein ompD [Escherichia coli Jurua 20/10] outer membrane porin protein ompD [Escherichia coli Jurua 18/11] outer membrane porin protein ompD [Escherichia coli 2735000] outer membrane porin protein ompD [Escherichia coli 199900.1] outer membrane porin protein ompD [Escherichia coli P0305260.1] outer membrane porin protein ompD [Escherichia coli P0299438.2] outer membrane porin protein ompD [Escherichia coli 179550] outer membrane porin protein ompD [Escherichia coli P0302308.10] outer membrane porin protein ompD [Escherichia coli P0302308.11] outer membrane porin protein ompD [Escherichia coli P0302308.3] outer membrane porin protein ompD [Escherichia coli P0302308.2] outer membrane porin protein ompD [Escherichia coli P0302308.5] outer membrane porin protein ompD [Escherichia coli P0302308.4] outer membrane porin protein ompD [Escherichia coli P0305260.2] outer membrane porin protein ompD [Escherichia coli P0304777.10] outer membrane porin protein ompD [Escherichia coli P0304777.11] outer membrane porin protein ompD [Escherichia coli P0304777.12] outer membrane porin protein ompD [Escherichia coli P0304777.13] outer membrane porin protein ompD [Escherichia coli P0304777.14] outer membrane porin protein ompD [Escherichia coli P0304777.15] outer membrane porin protein ompD [Escherichia coli P0304777.2] outer membrane porin protein ompD [Escherichia coli P0304777.3] outer membrane porin protein ompD [Escherichia coli P0304777.7] outer membrane porin protein ompD [Escherichia coli P0304777.5] outer membrane porin protein ompD [Escherichia coli P0304777.8] outer membrane porin protein ompD [Escherichia coli P0304777.9] outer membrane porin protein ompD [Escherichia coli P0305260.10] outer membrane porin protein ompD [Escherichia coli P0305260.11] outer membrane porin protein ompD [Escherichia coli P0305260.12] outer membrane porin protein ompD [Escherichia coli P0305260.13] outer membrane porin protein ompD [Escherichia coli P0305260.4] outer membrane porin protein ompD [Escherichia coli P0305260.5] outer membrane porin protein ompD [Escherichia coli P0305260.8] outer membrane porin protein ompD [Escherichia coli P0305260.9] outer membrane porin protein ompD [Escherichia coli P0302308.12] outer membrane porin protein ompD [Escherichia coli P0302308.13] outer membrane porin protein LC [Escherichia coli KTE13] outer membrane porin protein LC [Escherichia coli KTE222] outer membrane porin protein LC [Escherichia coli KTE100] outer membrane porin protein LC [Escherichia coli KTE108] outer membrane porin OmpD [Escherichia coli HVH 18 (4-8589585)] outer membrane porin OmpD [Escherichia coli HVH 33 (4-2174936)] outer membrane porin OmpD [Escherichia coli HVH 88 (4-5854636)] outer membrane porin OmpD [Escherichia coli HVH 121 (4-6877826)] outer membrane porin OmpD [Escherichia coli HVH 200 (4-4449924)] outer membrane porin OmpD [Escherichia coli KOEGE 33 (68a)] outer membrane porin OmpD [Escherichia coli UMEA 3355-1] outer membrane porin OmpD [Escherichia coli UMEA 3682-1] outer membrane porin OmpD [Escherichia coli UMEA 3955-1] outer membrane protein [Escherichia coli 907357] outer membrane protein [Escherichia coli 907710] outer membrane protein [Escherichia coli 908541] outer membrane porin OmpD [Escherichia coli UMEA 3693-1] outer membrane porin OmpD [Escherichia coli BIDMC 37] Outer membrane porin protein LC [Escherichia coli DORA_B_14] porin [Escherichia coli O121:H7 str. 2009C-3299] outer membrane porin protein LC [Escherichia coli UCI 66] outer membrane porin protein ompD [Escherichia coli 2-011-08_S1_C3] outer membrane porin protein ompD [Escherichia coli 3-105-05_S3_C1] outer membrane porin protein ompD [Escherichia coli 3-105-05_S3_C2] outer membrane porin protein ompD [Escherichia coli 3-267-03_S3_C2] outer membrane porin protein ompD [Escherichia coli 3-105-05_S3_C3] porin [Escherichia coli C691-71 (14b)] porin [Escherichia coli O139:H28 str. E24377A] outer membrane porin protein LC [Escherichia coli 97.0264] porin OmpC [Enterobacteriaceae bacterium TzEc013] porin [Escherichia sp. HH26CH] outer membrane porin protein LC [Escherichia coli E267] outer membrane protein N [Escherichia coli B175] outer membrane porin protein LC [Escherichia coli T426] outer membrane porin; DLP12 prophage [Escherichia coli IAI1] Outer membrane porin protein NmpC precursor [Escherichia coli IS9] Outer membrane porin [Escherichia coli D6-113.11] putative outer membrane porin protein [Escherichia coli SE11] |
0.0 | 98 | 99.392 | WP_000737266 |
porin [Escherichia coli] phosphoporin PhoE [Escherichia coli] |
0.0 | 98 | 99.392 | WP_095841903 |
porin [Escherichia coli] |
0.0 | 98 | 99.392 | WP_085458566 |
porin [Escherichia coli] |
0.0 | 98 | 99.392 | WP_115722717 |
porin [Escherichia coli] phosphoporin PhoE [Escherichia coli] porin OmpC [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] |
0.0 | 98 | 99.392 | WP_089624070 |
porin [Escherichia coli] outer membrane porin protein [Escherichia coli] |
0.0 | 98 | 99.091 | WP_137441514 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 97 | 99.390 | WP_040085036 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_097755802 |
outer membrane porin protein [Escherichia coli] |
0.0 | 98 | 99.088 | GDA26497 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli P0305260.6] |
0.0 | 98 | 99.088 | WP_001651754 |
porin [Escherichia coli] |
0.0 | 97 | 99.390 | WP_063101677 |
porin OmpC [Escherichia coli] |
0.0 | 98 | 99.088 | WP_139496555 |
porin [Escherichia coli] outer membrane porin protein [Escherichia coli] outer membrane porin protein [Escherichia coli] outer membrane porin protein [Escherichia coli] |
0.0 | 98 | 99.088 | WP_137542033 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_109554341 |
MULTISPECIES: porin [Escherichia] porin [Escherichia coli FAP1] phosphoporin PhoE [Escherichia coli O104:H21 str. CFSAN002236] porin [Escherichia coli O91 str. RM7190] phosphoporin PhoE [Escherichia coli O43 str. RM10042] porin [Escherichia coli O103] outer membrane porin protein LC [Escherichia coli E22] outer membrane porin protein LC [Escherichia coli B171] outer membrane porin protein nmpC [Escherichia coli B185] outer membrane porin protein LC [Escherichia coli MS 182-1] outer membrane porin protein LC [Escherichia coli MS 78-1] Outer membrane porin protein NmpC precursor [Escherichia coli EC4100B] outer membrane porin protein LC [Escherichia coli E128010] outer membrane porin protein LC [Escherichia coli STEC_B2F1] outer membrane porin protein LC [Escherichia coli 3030-1] outer membrane porin protein LC [Escherichia coli H494] outer membrane porin protein LC [Escherichia coli E101] outer membrane porin protein ompD [Escherichia coli DEC11A] outer membrane porin protein ompD [Escherichia coli DEC11B] outer membrane porin protein ompD [Escherichia coli DEC11C] outer membrane porin protein ompD [Escherichia coli DEC12A] outer membrane porin protein ompD [Escherichia coli DEC12B] outer membrane porin protein ompD [Escherichia coli DEC12C] outer membrane porin protein ompD [Escherichia coli DEC12D] outer membrane porin protein ompD [Escherichia coli DEC12E] outer membrane porin protein LC [Escherichia coli 96.0497] outer membrane porin protein LC [Escherichia coli 99.0741] outer membrane porin protein LC [Escherichia coli 3.2608] outer membrane porin protein LC [Escherichia coli 93.0624] outer membrane porin protein LC [Escherichia coli 96.154] outer membrane porin protein LC [Escherichia coli 9.0111] outer membrane porin protein [Escherichia coli O103:H2 str. CVM9450] outer membrane porin protein ompD [Escherichia coli EPEC C342-62] outer membrane porin protein LC [Escherichia coli KTE193] outer membrane porin protein LC [Escherichia coli KTE101] outer membrane porin protein LC [Escherichia coli KTE135] outer membrane porin protein LC [Escherichia coli KTE112] outer membrane porin protein LC [Escherichia coli KTE138] outer membrane porin protein [Escherichia coli O08] outer membrane porin protein ompD [Escherichia coli 174750] outer membrane porin protein ompD [Escherichia coli 2730350] outer membrane porin OmpD [Escherichia coli HVH 115 (4-4465989)] outer membrane porin OmpD [Escherichia coli HVH 115 (4-4465997)] outer membrane porin OmpD [Escherichia coli UMEA 3124-1] outer membrane porin OmpD [Escherichia coli UMEA 3201-1] outer membrane porin protein C [Escherichia coli O104:H21 str. CFSAN002237] outer membrane porin OmpD [Escherichia coli HVH 98 (4-5799287)] putative outer membrane porin protein [Escherichia coli ECC-Z] outer membrane porin protein C [Escherichia coli ATCC BAA-2215] outer membrane porin protein ompD [Escherichia coli 1-110-08_S1_C2] porin [Escherichia coli O45:H2 str. 2010C-3876] porin [Escherichia coli O103:H2 str. 2011C-3750] porin [Escherichia coli O153:H2 str. 2010C-5034] porin [Escherichia coli O103:H2 str. 2010C-4433] porin [Escherichia coli O45:H2 str. 01-3147] porin [Escherichia coli O113:H21 str. 07-4224] porin [Escherichia coli O104:H21 str. 94-3025] porin [Escherichia coli O103:H2 str. 2009C-3279] porin [Escherichia coli O45:H2 str. 2009C-3686] porin [Escherichia coli O91:NM str. 2009C-3745] porin [Escherichia coli O45:H2 str. 2009C-4780] porin [Escherichia coli O91:H21 str. 2009C-4646] porin OmpC [Enterobacteriaceae bacterium TzEc077] porin OmpC [Enterobacteriaceae bacterium TzEc052] outer membrane porin protein ompD [Escherichia coli 3-475-03_S4_C1] porin [Escherichia coli O146:H21 str. 2010C-3325] porin [Escherichia coli O91:H21 str. 2009C-3740] porin [Escherichia coli O45:H2 str. 2010C-4211] porin [Escherichia coli O128:H2 str. 2011C-3317] outer membrane porin protein [Escherichia coli K71] porin [Shigella sonnei] outer membrane porin protein LC [Escherichia coli H420] porin [Escherichia coli O113:H21] porin [Escherichia coli O91:H21] porin [Escherichia coli O103:H2] porin [Escherichia coli O45:H2] porin [Escherichia coli O22:H8] putative outer membrane porin protein [Escherichia coli O103:H2 str. 12009] |
0.0 | 98 | 99.088 | WP_000737283 |
porin OmpC [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_139932039 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_100004114 |
porin [Escherichia coli] outer membrane porin protein LC [Escherichia coli KTE14] |
0.0 | 98 | 99.088 | WP_016232482 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_112902516 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_052929254 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli 5-366-08_S3_C3] outer membrane porin protein ompD [Escherichia coli 5-366-08_S3_C1] porin OmpC [Escherichia coli] |
0.0 | 97 | 99.085 | WP_024249888 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli P0304777.4] |
0.0 | 98 | 99.088 | WP_001598266 |
porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_151309305 |
porin OmpC [Escherichia coli] |
0.0 | 98 | 99.088 | MWL00620 |
porin [Escherichia coli] phosphoporin PhoE [Escherichia coli] |
0.0 | 98 | 99.088 | WP_094472062 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_115762420 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli 2875000] |
0.0 | 98 | 99.088 | WP_001702988 |
porin OmpC [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 99.088 | WP_139497457 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 97 | 99.085 | WP_040090581 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | MKS05849 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli 3-475-03_S3_C1] outer membrane porin%3B DLP12 prophage [Escherichia coli] outer membrane porin%3B DLP12 prophage [Escherichia coli] outer membrane porin%3B DLP12 prophage [Escherichia coli] outer membrane porin%3B DLP12 prophage [Escherichia coli] |
0.0 | 98 | 98.784 | WP_032240978 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 99.088 | TZC22315 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | MHX43570 |
porin [Escherichia coli] |
0.0 | 98 | 99.088 | MHW18874 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 98.784 | WP_135563734 |
outer membrane porin protein ompD [Escherichia coli P0305260.3] |
0.0 | 98 | 99.392 | ENG07494 |
outer membrane protein N [Escherichia coli B367] |
0.0 | 98 | 99.392 | OSK91252 |
porin [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] |
0.0 | 98 | 98.784 | WP_112016637 |
porin [Escherichia coli] |
0.0 | 98 | 98.784 | MGA45140 |
porin [Escherichia coli] outer membrane porin protein [Escherichia coli] |
0.0 | 98 | 98.784 | WP_137589785 |
porin [Escherichia coli] |
0.0 | 98 | 98.784 | WP_024234034 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] phosphoporin PhoE [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 98.784 | WP_104211498 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli P0299438.9] outer membrane porin protein ompD [Escherichia coli P0305260.15] outer membrane porin protein ompD [Escherichia coli P0305260.7] |
0.0 | 98 | 99.088 | WP_001468347 |
porin [Escherichia coli] |
0.0 | 98 | 98.784 | EAC0689707 |
porin [Escherichia coli] outer membrane porin protein ompD [Escherichia coli P0302308.14] |
0.0 | 98 | 99.088 | WP_001497456 |
porin OmpD [Escherichia coli] Outer membrane porin protein OmpD [Escherichia coli] Outer membrane porin protein OmpD [Escherichia coli] |
0.0 | 98 | 99.392 | WP_109542680 |
porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 98 | 98.784 | WP_050877902 |
porin [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] outer membrane porin; DLP12 prophage [Escherichia coli] |
0.0 | 98 | 98.784 | WP_112081538 |
porin [Escherichia coli] porin [Escherichia coli] |
0.0 | 97 | 98.780 | WP_047662852 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_17 In anaero CP036345.1
Seq (len = 49 ):
MRFFLDTANVDEIREANEMGIICGVTTNPSIISKEGRDFKEDYRVAFVE
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|141954|-1|3477946-3478105
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
5.7121982700697735
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
fructose-6-phosphate aldolase, partial [Clostridium butyricum]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein ANACAC_02523 [Anaerostipes caccae DSM 14662] |
7.78e-25 | 94 | 100.000 | EDR97292 |
fructose-6-phosphate aldolase, partial [Clostridium butyricum] fructose-6-phosphate aldolase, partial [Clostridium butyricum] |
2.69e-18 | 84 | 85.366 | RQN02568 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium Oil+RF-744-WCA-WT-13] fructose-6-phosphate aldolase [Lachnospiraceae bacterium Oil+RF-744-WCA-WT-13] fructose-6-phosphate aldolase [Lachnospiraceae bacterium] fructose-6-phosphate aldolase [Lachnospiraceae bacterium] |
3e-18 | 84 | 87.805 | WP_154457030 |
fructose-6-phosphate aldolase [Clostridium roseum] transaldolase [Clostridium roseum] transaldolase [Clostridium roseum] |
3.77e-18 | 84 | 87.805 | WP_077835525 |
fructose-6-phosphate aldolase [Clostridium aurantibutyricum] transaldolase [Clostridium aurantibutyricum] |
4.06e-18 | 84 | 87.805 | WP_077852188 |
fructose-6-phosphate aldolase [Clostridium felsineum] transaldolase [Clostridium felsineum DSM 794] |
4.24e-18 | 84 | 87.805 | WP_077895238 |
fructose-6-phosphate aldolase, partial [Clostridium diolis] |
7.17e-18 | 84 | 82.927 | OVE67456 |
fructose-6-phosphate aldolase [Clostridium transplantifaecale] |
1.41e-17 | 84 | 85.366 | WP_125141346 |
fructose-6-phosphate aldolase [Clostridium sp. Marseille-P2415] |
1.43e-17 | 84 | 87.805 | WP_077611467 |
fructose-6-phosphate aldolase [Lachnoclostridium sp. An14] fructose-6-phosphate aldolase [Lachnoclostridium sp. An14] |
1.49e-17 | 84 | 85.366 | WP_087221968 |
transaldolase, partial [Clostridium sp. Maddingley MBC34-26] |
1.91e-17 | 84 | 80.488 | EKQ50466 |
fructose-6-phosphate aldolase [Lachnoclostridium sp. An14] fructose-6-phosphate aldolase [Lachnoclostridium sp. An14] |
1.95e-17 | 84 | 85.366 | WP_087223354 |
fructose-6-phosphate aldolase, partial [Clostridium diolis] |
2.1e-17 | 84 | 82.927 | WP_143758959 |
fructose-6-phosphate aldolase [Clostridium beijerinckii] fructose-6-phosphate aldolase [Clostridium beijerinckii] |
2.32e-17 | 84 | 82.927 | WP_041897762 |
fructose-6-phosphate aldolase [Clostridium saccharoperbutylacetonicum] transaldolase [Clostridium saccharoperbutylacetonicum] |
2.74e-17 | 84 | 82.927 | WP_077365827 |
fructose-6-phosphate aldolase [Brachyspira alvinipulli] |
2.77e-17 | 84 | 82.927 | WP_028331034 |
fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] |
2.78e-17 | 84 | 85.366 | WP_153739483 |
fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] |
2.94e-17 | 84 | 85.366 | WP_058146524 |
fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] |
2.94e-17 | 84 | 85.366 | WP_058877160 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridium] putative transaldolase [Clostridium butyricum 5521] putative transaldolase [Clostridium butyricum E4 str. BoNT E BL5262] putative transaldolase 1 [Clostridium butyricum DORA_1] fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] |
3e-17 | 84 | 85.366 | WP_003411556 |
fructose-6-phosphate aldolase [Succinivibrionaceae bacterium] |
3.09e-17 | 84 | 82.927 | HAH71231 |
fructose-6-phosphate aldolase [Clostridium butyricum] |
3.13e-17 | 84 | 85.366 | WP_148347309 |
fructose-6-phosphate aldolase, partial [Coprobacillus sp. D7] |
3.34e-17 | 84 | 82.927 | EQM95677 |
fructose-6-phosphate aldolase, partial [Clostridium beijerinckii] fructose-6-phosphate aldolase, partial [Clostridium beijerinckii] |
3.54e-17 | 84 | 82.927 | WP_078115631 |
fructose-6-phosphate aldolase, partial [Clostridium beijerinckii] fructose-6-phosphate aldolase, partial [Clostridium beijerinckii] |
3.76e-17 | 84 | 82.927 | WP_065416509 |
fructose-6-phosphate aldolase [Clostridium sp. ASBs410] fructose-6-phosphate aldolase, TalC/MipB family [Clostridium sp. ASBs410] |
3.98e-17 | 84 | 85.366 | WP_025232189 |
fructose-6-phosphate aldolase [Clostridium sp. TF11-13AC] fructose-6-phosphate aldolase [Clostridium sp. TF11-13AC] |
4.05e-17 | 84 | 85.366 | WP_118637929 |
fructose-6-phosphate aldolase [Brachyspira hampsonii] fructose-6-phosphate aldolase [Brachyspira hampsonii] |
4.11e-17 | 84 | 82.927 | WP_069727184 |
fructose-6-phosphate aldolase [[Clostridium] sphenoides] transaldolase [[Clostridium] sphenoides JCM 1415] transaldolase [[Clostridium] sphenoides] |
4.15e-17 | 84 | 85.366 | WP_054789379 |
fructose-6-phosphate aldolase [Succinivibrionaceae bacterium] |
4.16e-17 | 84 | 82.927 | HAR79732 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridiales] fructose-6-phosphate aldolase [Lachnoclostridium sp. SNUG30386] fructose-6-phosphate aldolase [Clostridium sp. AM18-55] fructose-6-phosphate aldolase [Clostridium sp. AF37-7] fructose-6-phosphate aldolase [Clostridium sp. AF32-7AC] fructose-6-phosphate aldolase [Clostridium sp. AF27-5AA] |
4.27e-17 | 84 | 85.366 | WP_107000581 |
fructose-6-phosphate aldolase [Clostridium transplantifaecale] |
4.27e-17 | 84 | 85.366 | WP_125144580 |
MULTISPECIES: fructose-6-phosphate aldolase [unclassified Clostridium] probable transaldolase 1 [Clostridium sp. CAG:43] fructose-6-phosphate aldolase [Clostridium sp. AF12-41] fructose-6-phosphate aldolase [Clostridium sp. AF50-3] fructose-6-phosphate aldolase [Clostridium sp. AF35-15] fructose-6-phosphate aldolase [Clostridium sp. AF29-8BH] |
4.32e-17 | 84 | 85.366 | WP_022358583 |
MULTISPECIES: fructose-6-phosphate aldolase [Thermoanaerobacterium] transaldolase [Thermoanaerobacterium xylanolyticum LX-11] transaldolase [Thermoanaerobacterium saccharolyticum JW/SL-YS485] transaldolase [Thermoanaerobacterium aotearoense SCUT27] |
4.55e-17 | 84 | 82.927 | WP_013788937 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridiales] hypothetical protein HMPREF9474_04444 [ [[Clostridium] symbiosum WAL-14163] fructose-6-phosphate aldolase [[Clostridium] symbiosum WAL-14673] fructose-6-phosphate aldolase [[Clostridium] symbiosum ATCC 14940] Transaldolase [uncultured Clostridium sp.] transaldolase [Clostridium sp. 7_3_54FAA] |
4.65e-17 | 84 | 85.366 | WP_003504935 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridia] transaldolase [Thermoanaerobacterium thermosaccharolyticum DSM 571] fructose-6-phosphate aldolase, TalC/MipB family [Thermoanaerobacterium thermosaccharolyticum M0795] transaldolase [Thermoanaerobacterium thermosaccharolyticum] fructose-6-phosphate aldolase [Thermoanaerobacterium thermosaccharolyticum] fructose-6-phosphate aldolase [Thermoanaerobacterium thermosaccharolyticum] |
4.75e-17 | 84 | 82.927 | WP_013298953 |
fructose-6-phosphate aldolase [Thermoanaerobacterium saccharolyticum] |
4.75e-17 | 84 | 82.927 | WP_045413155 |
probable transaldolase [Clostridium sp. CAG:299] |
4.81e-17 | 84 | 82.927 | CDD45001 |
fructose-6-phosphate aldolase [Clostridium butyricum] putative transaldolase 1 [Clostridium butyricum] |
5.06e-17 | 84 | 82.927 | WP_146869179 |
fructose-6-phosphate aldolase [Clostridium sp. AM29-11AC] fructose-6-phosphate aldolase [Clostridium sp. AM29-11AC] transaldolase, putative, TalC family [[Clostridium] cf. saccharolyticum K10] transaldolase, putative, TalC family [butyrate-producing bacterium SM4/1] |
5.23e-17 | 84 | 82.927 | WP_015544546 |
probable transaldolase [Clostridium sp. CAG:149] |
5.46e-17 | 84 | 82.927 | CCY85243 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridiales] fructose-6-phosphate aldolase [Clostridium sp. M62/1] fructose-6-phosphate aldolase [[Clostridium] saccharolyticum] |
5.58e-17 | 84 | 82.927 | WP_008397122 |
fructose-6-phosphate aldolase, partial [Clostridium sp. USBA 49] transaldolase, partial [Clostridium sp. USBA 49] |
5.77e-17 | 84 | 82.927 | WP_078682603 |
fructose-6-phosphate aldolase [Clostridium sp. PI-S10-A1B] fructose-6-phosphate aldolase [Clostridium sp. PI-S10-A1B] |
5.97e-17 | 84 | 82.927 | WP_117415608 |
fructose-6-phosphate aldolase [Clostridium chromiireducens] transaldolase [Clostridium chromiireducens] |
6.4e-17 | 84 | 82.927 | WP_079438823 |
fructose-6-phosphate aldolase [Clostridium chromiireducens] |
6.47e-17 | 84 | 82.927 | MVX65764 |
fructose-6-phosphate aldolase [[Clostridium] indolis] |
6.5e-17 | 84 | 85.366 | WP_024296388 |
fructose-6-phosphate aldolase [Clostridium chromiireducens] fructose-6-phosphate aldolase [Clostridium chromiireducens] |
6.61e-17 | 84 | 82.927 | WP_119368142 |
fructose-6-phosphate aldolase [Clostridium beijerinckii] |
6.75e-17 | 84 | 82.927 | WP_026887402 |
fructose-6-phosphate aldolase [Clostridium saccharoperbutylacetonicum] transaldolase [Clostridium saccharoperbutylacetonicum] |
6.93e-17 | 84 | 80.488 | WP_077362416 |
fructose-6-phosphate aldolase [Hungatella sp.] |
6.93e-17 | 84 | 82.927 | MTK07986 |
MULTISPECIES: fructose-6-phosphate aldolase [Bacteria] fructose-6-phosphate aldolase [Parabacteroides distasonis] fructose-6-phosphate aldolase [Clostridium beijerinckii] |
7.12e-17 | 84 | 82.927 | WP_078114383 |
fructose-6-phosphate aldolase [Clostridium beijerinckii] |
7.12e-17 | 84 | 82.927 | WP_026885010 |
fructose-6-phosphate aldolase [Clostridium saccharoperbutylacetonicum] fructose-6-phosphate aldolase, TalC/MipB family [Clostridium saccharoperbutylacetonicum N1-4(HMT)] |
7.15e-17 | 84 | 80.488 | WP_015392441 |
fructose-6-phosphate aldolase, partial [Clostridium sp. USBA 49] transaldolase, partial [Clostridium sp. USBA 49] |
7.16e-17 | 84 | 82.927 | WP_078683057 |
fructose-6-phosphate aldolase [Clostridium beijerinckii] fructose-6-phosphate aldolase [Clostridium beijerinckii] |
7.2e-17 | 84 | 82.927 | WP_041898315 |
fructose-6-phosphate aldolase [Lachnoclostridium sp.] |
7.47e-17 | 84 | 85.366 | HCD44398 |
fructose-6-phosphate aldolase [Clostridium beijerinckii] transaldolase [Clostridium beijerinckii] fructose-6-phosphate aldolase [Clostridium beijerinckii] |
7.51e-17 | 84 | 82.927 | WP_065417615 |
unnamed protein product putative transaldolase [Clostridium beijerinckii NCIMB 8052] putative transaldolase [Clostridium beijerinckii ATCC 35702] fructose-6-phosphate aldolase [Clostridium beijerinckii NRRL B-598] putative transaldolase [Clostridium beijerinckii NCIMB 8052] putative transaldolase [Clostridium beijerinckii ATCC 35702] |
7.51e-17 | 84 | 82.927 | WP_012058602 |
unnamed protein product fructose-6-phosphate aldolase [Clostridium beijerinckii NRRL B-598] fructose-6-phosphate aldolase [Clostridium beijerinckii] fructose-6-phosphate aldolase [Clostridium beijerinckii] transaldolase [Clostridium beijerinckii] fructose-6-phosphate aldolase [Clostridium sp. MF28] |
7.51e-17 | 84 | 82.927 | WP_023975892 |
fructose-6-phosphate aldolase [Clostridium beijerinckii] fructose-6-phosphate aldolase [Clostridium beijerinckii] |
7.51e-17 | 84 | 82.927 | WP_065417776 |
fructose-6-phosphate aldolase, partial [Erysipelatoclostridium ramosum] fructose-6-phosphate aldolase, partial [Erysipelatoclostridium ramosum] |
7.58e-17 | 80 | 84.615 | RGS83474 |
fructose-6-phosphate aldolase [Clostridium beijerinckii] putative transaldolase [Clostridium beijerinckii NCIMB 8052] putative transaldolase [Clostridium beijerinckii ATCC 35702] |
7.59e-17 | 84 | 82.927 | WP_012060610 |
fructose-6-phosphate aldolase [Bacteroides xylanolyticus] transaldolase [Bacteroides xylanolyticus] |
7.63e-17 | 84 | 82.927 | WP_104438860 |
MULTISPECIES: fructose-6-phosphate aldolase [unclassified Clostridium] probable transaldolase [Clostridium sp. CAG:7] fructose-6-phosphate aldolase [Clostridium sp. AM22-11AC] fructose-6-phosphate aldolase [Clostridium sp. AM51-4] fructose-6-phosphate aldolase [Clostridium sp. TM06-18] fructose-6-phosphate aldolase [Clostridium sp. OM04-12AA] |
7.71e-17 | 84 | 82.927 | WP_021868765 |
fructose-6-phosphate aldolase [Clostridium sp. BL-8] transaldolase [Clostridium sp. BL-8] |
7.84e-17 | 84 | 82.927 | WP_077861837 |
fructose-6-phosphate aldolase [Clostridiaceae bacterium] |
7.88e-17 | 84 | 82.927 | WP_158376456 |
fructose-6-phosphate aldolase [Clostridium sp. AM32-2] fructose-6-phosphate aldolase [Clostridium sp. AM32-2] |
7.88e-17 | 84 | 82.927 | WP_118740322 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridiales] transaldolase [[Clostridium] celerecrescens] fructose-6-phosphate aldolase [Clostridium sp. WB02_MRS01] |
7.96e-17 | 84 | 85.366 | WP_038277881 |
fructose-6-phosphate aldolase [Lachnoclostridium sp.] |
8.22e-17 | 84 | 85.366 | HBD00822 |
fructose-6-phosphate aldolase [Brachyspira sp. SAP_772] |
8.31e-17 | 84 | 80.488 | WP_157152150 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridium] transaldolase [Clostridium butyricum] transaldolase [Clostridium butyricum] Transaldolase [Clostridium sp. IBUN125C] Transaldolase [Clostridium sp. IBUN22A] chloride channel [Clostridium sp. IBUN13A] |
8.36e-17 | 84 | 82.927 | WP_043662341 |
fructose-6-phosphate aldolase [Clostridium butyricum] transaldolase [Clostridium butyricum] |
8.36e-17 | 84 | 82.927 | WP_057087627 |
fructose-6-phosphate aldolase [Clostridium sp. C105KSO15] Transaldolase [Clostridium sp. C105KSO15] |
8.4e-17 | 84 | 85.366 | WP_089994417 |
fructose-6-phosphate aldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii 30446] fructose-6-phosphate aldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii bv. II] |
8.49e-17 | 84 | 80.488 | WP_008721282 |
fructose-6-phosphate aldolase [Clostridium butyricum] putative transaldolase [Clostridium butyricum DKU-01] |
8.54e-17 | 84 | 82.927 | WP_003430554 |
MULTISPECIES: fructose-6-phosphate aldolase [Brachyspira] |
8.58e-17 | 84 | 80.488 | WP_020004072 |
fructose-6-phosphate aldolase [Brachyspira pilosicoli] fructose-6-phosphate aldolase [Brachyspira pilosicoli] |
8.58e-17 | 84 | 80.488 | WP_147731275 |
fructose-6-phosphate aldolase [Clostridium sp. SYSU GA15002T] |
8.73e-17 | 84 | 82.927 | WP_139904461 |
fructose-6-phosphate aldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii 30599] fructose-6-phosphate aldolase [Brachyspira hampsonii] |
8.95e-17 | 84 | 80.488 | WP_008732125 |
fructose-6-phosphate aldolase [Clostridium saccharobutylicum] transaldolase Tal [Clostridium saccharobutylicum DSM 13864] transaldolase [Clostridium saccharobutylicum] transaldolase [Clostridium saccharobutylicum] transaldolase [Clostridium saccharobutylicum] transaldolase [Clostridium saccharobutylicum] |
9.21e-17 | 84 | 80.488 | WP_022747403 |
fructose-6-phosphate aldolase [Brachyspira suanatina] Probable transaldolase [Brachyspira suanatina] |
9.64e-17 | 84 | 80.488 | WP_048593242 |
fructose-6-phosphate aldolase [Clostridium sp. HBUAS56017] |
9.71e-17 | 84 | 82.927 | WP_143317950 |
fructose-6-phosphate aldolase [[Clostridium] methylpentosum] fructose-6-phosphate aldolase [[Clostridium] methylpentosum DSM 5476] |
9.86e-17 | 84 | 78.049 | WP_006353426 |
fructose-6-phosphate aldolase [Brachyspira murdochii] transaldolase [Brachyspira murdochii] |
1.04e-16 | 84 | 80.488 | WP_104618168 |
fructose-6-phosphate aldolase [Brachyspira murdochii] transaldolase [Brachyspira murdochii DSM 12563] |
1.04e-16 | 84 | 80.488 | WP_013113983 |
fructose-6-phosphate aldolase [Clostridium chromiireducens] transaldolase [Clostridium chromiireducens] fructose-6-phosphate aldolase [Clostridium chromiireducens] |
1.06e-16 | 84 | 80.488 | WP_079441609 |
fructose-6-phosphate aldolase [Clostridium chromiireducens] |
1.07e-16 | 84 | 80.488 | MVX64736 |
fructose-6-phosphate aldolase [Clostridium sp. E02] |
1.08e-16 | 84 | 80.488 | WP_124067983 |
fructose-6-phosphate aldolase [Clostridium chromiireducens] fructose-6-phosphate aldolase [Clostridium chromiireducens] transaldolase [Clostridium chromiireducens] fructose-6-phosphate aldolase [Clostridium chromiireducens] |
1.09e-16 | 84 | 80.488 | WP_079441633 |
fructose-6-phosphate aldolase, TalC/MipB family [Clostridium sp. Maddingley MBC34-26] |
1.09e-16 | 84 | 80.488 | EKQ50890 |
fructose-6-phosphate aldolase [Clostridiales bacterium] |
1.14e-16 | 84 | 82.927 | HCC03301 |
fructose-6-phosphate aldolase [Clostridiales bacterium oral taxon 876] fructose-6-phosphate aldolase [Clostridiales bacterium oral taxon 876 str. F0540] |
1.21e-16 | 84 | 80.488 | WP_021655216 |
fructose-6-phosphate aldolase [Clostridium ljungdahlii] Transaldolase [Clostridium ljungdahlii] |
1.21e-16 | 84 | 80.488 | WP_063555099 |
fructose-6-phosphate aldolase [Clostridium ragsdalei] transaldolase [Clostridium ragsdalei P11] |
1.21e-16 | 84 | 80.488 | WP_065078448 |
fructose-6-phosphate aldolase [Clostridium sp. AWRP] fructose-6-phosphate aldolase [Clostridium sp. AWRP] |
1.28e-16 | 84 | 80.488 | WP_127723241 |
fructose-6-phosphate aldolase [Clostridium saccharoperbutylacetonicum] fructose-6-phosphate aldolase, TalC/MipB family [Clostridium saccharoperbutylacetonicum N1-4(HMT)] |
1.31e-16 | 84 | 80.488 | WP_015394753 |
fructose-6-phosphate aldolase [Clostridium puniceum] transaldolase [Clostridium puniceum] |
1.32e-16 | 84 | 80.488 | WP_077846350 |
fructose-6-phosphate aldolase [Clostridium saccharoperbutylacetonicum] transaldolase [Clostridium saccharoperbutylacetonicum] |
1.33e-16 | 84 | 80.488 | WP_077365801 |
fructose-6-phosphate aldolase [Clostridium saccharoperbutylacetonicum] putative transaldolase Tal [Clostridium saccharoperbutylacetonicum N1-4(HMT)] |
1.34e-16 | 84 | 80.488 | WP_015394738 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_18 In lacto CP039121.1
Seq (len = 35 ):
ISTSTLTRSLTSLAIKAVLKLAKPCETDFSSEKKW
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|28614|1|505017-505125
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.029498156959376
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_19 In lacto CP039121.1
Seq (len = 55 ):
LYKARPASPKSNLSKVVVTCLTVAFKRLKIHLSANVQSLAAGNSGLSMVPRFMIT
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|114392|1|2142181-2142415
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
3.2781893847874533
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_20 In ery NZ_CP036346.1
Seq (len = 99 ):
LAARAGATYVSPFVGRIDDISMDGLQLIRDIAAIFKTHDIKAQIISASVRNACHVIECAKAGADLATVPYSVIEQMLKHPLTAEGIEKFQKDYRAVFGG
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|61530|1|880877-881198
Transkriptom
87.0% of gene length expressed over median expression of contig.
ŝ
4.537103099711999
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
fructose-6-phosphate aldolase, partial [Coprobacillus sp. 3_3_56FAA]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
fructose-6-phosphate aldolase, partial [Coprobacillus sp. 3_3_56FAA] |
5.33e-66 | 100 | 100.000 | EHM93194 |
putative transaldolase [Erysipelatoclostridium ramosum] |
9.2e-66 | 100 | 100.000 | VEU18574 |
fructose-6-phosphate aldolase, partial [Erysipelatoclostridium ramosum] fructose-6-phosphate aldolase, partial [Erysipelatoclostridium ramosum] fructose-6-phosphate aldolase, partial [Erysipelatoclostridium ramosum] |
1.45e-65 | 100 | 100.000 | WP_117792825 |
fructose-6-phosphate aldolase [Clostridia bacterium UC5.1-2H6] |
2.58e-65 | 100 | 100.000 | WP_082401737 |
fructose-6-phosphate aldolase [Erysipelotrichaceae bacterium] fructose-6-phosphate aldolase [Coprobacillus sp. 8_2_54BFAA] |
3.2e-65 | 100 | 100.000 | WP_008792025 |
probable transaldolase [Coprobacillus sp. CAG:183] |
3.45e-65 | 100 | 100.000 | CCZ31926 |
MULTISPECIES: fructose-6-phosphate aldolase [Erysipelotrichaceae] fructose-6-phosphate aldolase [Coprobacillus sp. D7] fructose-6-phosphate aldolase [Coprobacillus sp. AF09-1A] fructose-6-phosphate aldolase [Coprobacillus sp. 3_3_56FAA] fructose-6-phosphate aldolase [Erysipelatoclostridium ramosum] fructose-6-phosphate aldolase [Erysipelatoclostridium ramosum] |
3.61e-65 | 100 | 100.000 | WP_009299512 |
fructose-6-phosphate aldolase [Erysipelatoclostridium ramosum DSM 1402] |
5.71e-65 | 100 | 100.000 | EDS18018 |
fructose-6-phosphate aldolase [Erysipelatoclostridium ramosum] fructose-6-phosphate aldolase [Erysipelatoclostridium ramosum] |
9.82e-64 | 100 | 98.990 | WP_118232834 |
fructose-6-phosphate aldolase, partial [Coprobacillus sp. 3_3_56FAA] |
3.99e-63 | 96 | 100.000 | EHM93630 |
hypothetical protein CLORAM_00252 [Erysipelatoclostridium ramosum DSM 1402] |
5.41e-50 | 79 | 100.000 | EDS20159 |
fructose-6-phosphate aldolase [Brachyspira sp. CAG:700] probable transaldolase [Brachyspira sp. CAG:700] |
3.99e-49 | 99 | 78.571 | WP_021958464 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
6.55e-49 | 99 | 79.592 | WP_147736514 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
1.99e-48 | 99 | 78.571 | WP_147529469 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
2.1e-48 | 99 | 78.571 | WP_147770781 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
2.15e-48 | 99 | 78.571 | WP_147558614 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
2.15e-48 | 99 | 78.571 | WP_147735304 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
2.27e-48 | 99 | 78.571 | WP_147778376 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
2.3e-48 | 99 | 78.571 | WP_147527712 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
2.5e-48 | 99 | 78.571 | WP_147759016 |
fructose-6-phosphate aldolase [Brachyspira hyodysenteriae] RecName: Full=Probable transaldolase [Brachyspira hyodysenteriae WA1] fructose-6-phosphate aldolase [Brachyspira hyodysenteriae ATCC 27164] transaldolase [Brachyspira hyodysenteriae WA1] transaldolase [Brachyspira hyodysenteriae] transaldolase [Brachyspira hyodysenteriae] transaldolase [Brachyspira hyodysenteriae] |
2.89e-48 | 99 | 77.551 | WP_012671468 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
3.92e-48 | 99 | 78.571 | WP_147531099 |
fructose-6-phosphate aldolase [Brachyspira catarrhinii] fructose-6-phosphate aldolase [Brachyspira catarrhinii] |
5.8e-48 | 99 | 77.551 | WP_137998457 |
fructose-6-phosphate aldolase [Coprobacillus cateniformis] fructose-6-phosphate aldolase [Coprobacillus sp.] transaldolase [Coprobacillus cateniformis] fructose-6-phosphate aldolase [Coprobacillus cateniformis] fructose-6-phosphate aldolase [Coprobacillus cateniformis] fructose-6-phosphate aldolase [Coprobacillus cateniformis] |
7.29e-48 | 99 | 75.510 | WP_008790665 |
fructose-6-phosphate aldolase [Brachyspira hyodysenteriae] transaldolase [Brachyspira hyodysenteriae] |
8.13e-48 | 99 | 76.531 | WP_047117565 |
hypothetical protein HMPREF1021_00728 [Coprobacillus sp. 3_3_56FAA] |
1.23e-47 | 77 | 98.684 | EHM93226 |
fructose-6-phosphate aldolase [Brachyspira suanatina] Probable transaldolase [Brachyspira suanatina] |
1.42e-47 | 99 | 76.531 | WP_048593242 |
fructose-6-phosphate aldolase [Brachyspira aalborgi] fructose-6-phosphate aldolase [Brachyspira aalborgi] |
3.83e-47 | 99 | 77.551 | WP_147738757 |
fructose-6-phosphate aldolase [Brachyspira hyodysenteriae] transaldolase [Brachyspira hyodysenteriae] fructose-6-phosphate aldolase [Brachyspira hyodysenteriae] fructose-6-phosphate aldolase [Brachyspira hyodysenteriae] |
4.27e-47 | 99 | 76.531 | WP_047108570 |
fructose-6-phosphate aldolase [Brachyspira pilosicoli] fructose-6-phosphate aldolase [Brachyspira pilosicoli] |
4.51e-47 | 99 | 76.531 | WP_147731275 |
fructose-6-phosphate aldolase [Clostridium tertium] |
5.73e-47 | 94 | 76.344 | WP_097033373 |
fructose-6-phosphate aldolase [Brachyspira intermedia] transaldolase [Brachyspira intermedia PWS/A] |
7.69e-47 | 99 | 76.531 | WP_014489118 |
MULTISPECIES: fructose-6-phosphate aldolase [Brachyspira] |
1.19e-46 | 99 | 76.531 | WP_020004072 |
fructose-6-phosphate aldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii 30599] fructose-6-phosphate aldolase [Brachyspira hampsonii] |
1.48e-46 | 99 | 75.510 | WP_008732125 |
fructose-6-phosphate aldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii 30446] fructose-6-phosphate aldolase [Brachyspira hampsonii] transaldolase [Brachyspira hampsonii bv. II] |
1.5e-46 | 99 | 75.510 | WP_008721282 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium] |
1.69e-46 | 99 | 73.469 | HCO28483 |
fructose-6-phosphate aldolase [Brachyspira sp. SAP_772] |
2.82e-46 | 99 | 75.510 | WP_157152150 |
fructose-6-phosphate aldolase [Brachyspira pilosicoli] transaldolase [Brachyspira pilosicoli B2904] transaldolase [Brachyspira pilosicoli P43/6/78] transaldolase [Brachyspira pilosicoli WesB] transaldolase [Brachyspira pilosicoli] transaldolase [Brachyspira pilosicoli] |
3.39e-46 | 99 | 75.510 | WP_014933966 |
transaldolase [Brachyspira pilosicoli 95/1000] |
5.55e-46 | 99 | 75.510 | ADK31085 |
fructose-6-phosphate aldolase [Brachyspira alvinipulli] |
5.78e-46 | 99 | 75.510 | WP_028331034 |
fructose-6-phosphate aldolase [Brachyspira pilosicoli] transaldolase [Brachyspira pilosicoli SP16] |
1.12e-45 | 99 | 74.490 | WP_101504065 |
fructose-6-phosphate aldolase [Listeria fleischmannii] translaldolase [Listeria fleischmannii FSL S10-1203] |
4.03e-45 | 96 | 74.737 | WP_036064362 |
fructose-6-phosphate aldolase [Brachyspira sp. G79] transaldolase [Brachyspira sp. G79] |
4.16e-45 | 99 | 74.490 | WP_096737394 |
fructose-6-phosphate aldolase [Listeria fleischmannii] putative translaldolase [Listeria fleischmannii subsp. coloradonensis] translaldolase [Listeria fleischmannii subsp. fleischmannii LU2006-1] translaldolase [Listeria fleischmannii 1991] Transaldolase [Listeria fleischmannii subsp. fleischmannii] Transaldolase [Listeria fleischmannii subsp. coloradonensis] |
4.35e-45 | 96 | 74.737 | WP_007473156 |
MULTISPECIES: fructose-6-phosphate aldolase [Propionispira] transaldolase [Propionispira arboris] |
4.74e-45 | 99 | 73.469 | WP_019555658 |
fructose-6-phosphate aldolase [Massilioclostridium coli] |
5.64e-45 | 99 | 74.490 | WP_069987369 |
fructose-6-phosphate aldolase [Clostridium sp. AM58-1XD] fructose-6-phosphate aldolase [Clostridium sp. AM58-1XD] |
6.16e-45 | 99 | 73.469 | WP_118242329 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium] |
7.66e-45 | 99 | 74.490 | WP_158429794 |
fructose-6-phosphate aldolase [Coprococcus sp. OM04-5BH] fructose-6-phosphate aldolase [Coprococcus sp. OM04-5BH] |
9.84e-45 | 99 | 72.449 | WP_118694468 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridiales] fructose-6-phosphate aldolase [[Clostridium] clostridioforme 90A7] fructose-6-phosphate aldolase [[Clostridium] bolteae 90B8] fructose-6-phosphate aldolase [[Clostridium] bolteae 90B3] fructose-6-phosphate aldolase [[Clostridium] bolteae 90A9] fructose-6-phosphate aldolase [[Clostridium] bolteae 90A5] fructose-6-phosphate aldolase [[Clostridium] bolteae 90B7] transaldolase [[Clostridium] bolteae WAL-14578] probable transaldolase [Clostridium bolteae CAG:59] |
1.07e-44 | 99 | 71.429 | WP_002569030 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridiales] transaldolase [ [[Clostridium] clostridioforme 2_1_49FAA] fructose-6-phosphate aldolase [[Clostridium] clostridioforme CM201] fructose-6-phosphate aldolase [[Clostridium] clostridioforme 90B1] fructose-6-phosphate aldolase [[Clostridium] clostridioforme 90A8] fructose-6-phosphate aldolase [[Clostridium] clostridioforme 90A3] fructose-6-phosphate aldolase [[Clostridium] clostridioforme 90A1] fructose-6-phosphate aldolase [[Clostridium] clostridioforme 90A6] fructose-6-phosphate aldolase [[Clostridium] clostridioforme 90A4] transaldolase [[Clostridium] clostridioforme WAL-7855] probable transaldolase [Clostridium clostridioforme CAG:132] |
1.21e-44 | 99 | 71.429 | WP_002586721 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium 3-1] fructose-6-phosphate aldolase [Lachnospiraceae bacterium 3-1] |
1.24e-44 | 99 | 71.429 | WP_016287052 |
fructose-6-phosphate aldolase [[Clostridium] clostridioforme] |
1.26e-44 | 99 | 71.429 | WP_027643209 |
MULTISPECIES: fructose-6-phosphate aldolase [unclassified Lactonifactor] fructose-6-phosphate aldolase [Lactonifactor sp. BIOML-A5] fructose-6-phosphate aldolase [Lactonifactor sp. BIOML-A4] fructose-6-phosphate aldolase [Lactonifactor sp. BIOML-A3] fructose-6-phosphate aldolase [Lactonifactor sp. BIOML-A2] fructose-6-phosphate aldolase [Lactonifactor sp. BIOML-A1] |
1.85e-44 | 99 | 74.490 | WP_154261432 |
fructose-6-phosphate aldolase [Anaerobium acetethylicum] transaldolase [Anaerobium acetethylicum] |
2.43e-44 | 99 | 72.449 | WP_091236560 |
fructose-6-phosphate aldolase [[Desulfotomaculum] guttoideum] transaldolase [[Desulfotomaculum] guttoideum] |
3.48e-44 | 99 | 72.449 | WP_092240202 |
fructose-6-phosphate aldolase [Lactonifactor longoviformis] fructose-6-phosphate aldolase [Lactonifactor longoviformis] transaldolase [Lactonifactor longoviformis DSM 17459] |
3.8e-44 | 99 | 74.490 | WP_072854502 |
hypothetical protein CLOBOL_01444 [[Clostridium] bolteae ATCC BAA-613] |
4.21e-44 | 99 | 71.429 | EDP18090 |
fructose-6-phosphate aldolase [Anaerostipes caccae] fructose-6-phosphate aldolase [Anaerostipes caccae DSM 14662] |
4.47e-44 | 99 | 73.469 | WP_006566543 |
fructose-6-phosphate aldolase [Clostridium butyricum] |
4.83e-44 | 99 | 68.367 | MUO76909 |
fructose-6-phosphate aldolase [Blautia sp. An249] fructose-6-phosphate aldolase [Blautia sp. An249] |
6.21e-44 | 99 | 70.408 | WP_087224763 |
fructose-6-phosphate aldolase, partial [Clostridium butyricum] |
7.24e-44 | 99 | 68.367 | WP_156737134 |
fructose-6-phosphate aldolase [Lachnospira multipara] |
7.31e-44 | 99 | 72.449 | WP_027438395 |
fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] |
8.12e-44 | 99 | 69.388 | WP_153739157 |
fructose-6-phosphate aldolase [Clostridium butyricum] putative transaldolase [Clostridium butyricum 5521] putative transaldolase [Clostridium butyricum E4 str. BoNT E BL5262] fructose-6-phosphate aldolase [Clostridium butyricum] transaldolase [Clostridium butyricum] fructose-6-phosphate aldolase [Clostridium butyricum] |
8.3e-44 | 99 | 69.388 | WP_003410428 |
probable transaldolase [Coprococcus sp. CAG:782] |
9.81e-44 | 99 | 70.408 | CCY54163 |
fructose-6-phosphate aldolase [[Clostridium] saccharolyticum] transaldolase [[Clostridium] saccharolyticum WM1] |
1.02e-43 | 99 | 72.449 | WP_013272173 |
fructose-6-phosphate aldolase [Succinatimonas hippei] fructose-6-phosphate aldolase [Succinatimonas hippei YIT 12066] |
1.06e-43 | 99 | 73.469 | WP_009144142 |
fructose-6-phosphate aldolase [Coprococcus sp. AF21-14LB] fructose-6-phosphate aldolase [Coprococcus sp. AF21-14LB] |
1.07e-43 | 99 | 71.429 | WP_118348882 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium] |
1.07e-43 | 99 | 69.388 | HBZ03659 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium KM106-2] transaldolase [Lachnospiraceae bacterium KM106-2] |
1.09e-43 | 99 | 72.449 | WP_155880942 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium] transaldolase [Lachnospiraceae bacterium] |
1.13e-43 | 99 | 69.388 | WP_094175341 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium WCA-693-APC-MOT-I] fructose-6-phosphate aldolase [Lachnospiraceae bacterium WCA-693-APC-MOT-I] |
1.14e-43 | 99 | 72.449 | WP_154519340 |
fructose-6-phosphate aldolase [Anaerocolumna xylanovorans] transaldolase [Anaerocolumna xylanovorans DSM 12503] |
1.18e-43 | 99 | 70.408 | WP_073591333 |
fructose-6-phosphate aldolase [Anaerocolumna jejuensis] transaldolase [Anaerocolumna jejuensis DSM 15929] |
1.37e-43 | 99 | 73.469 | WP_073278657 |
fructose-6-phosphate aldolase [[Clostridium] sphenoides] transaldolase [[Clostridium] sphenoides JCM 1415] transaldolase [[Clostridium] sphenoides] |
1.45e-43 | 99 | 72.449 | WP_100041608 |
fructose-6-phosphate aldolase [Succinivibrio dextrinosolvens] transaldolase [Succinivibrio dextrinosolvens] transaldolase [Succinivibrio dextrinosolvens] transaldolase [Succinivibrio dextrinosolvens DSM 3072] |
1.47e-43 | 99 | 72.449 | WP_031491420 |
fructose-6-phosphate aldolase [Lachnospiraceae bacterium] |
1.48e-43 | 99 | 72.449 | HBA64207 |
fructose-6-phosphate aldolase [Selenomonas sp. oral taxon 137] |
1.87e-43 | 99 | 72.449 | WP_037350070 |
fructose-6-phosphate aldolase [Selenomonas sp. oral taxon 137 str. F0430] |
1.91e-43 | 99 | 72.449 | EFR41686 |
fructose-6-phosphate aldolase [Selenomonas artemidis] |
1.96e-43 | 99 | 72.449 | WP_026762353 |
fructose-6-phosphate aldolase [Anaerostipes sp. BG01] |
1.99e-43 | 99 | 72.449 | WP_024728438 |
fructose-6-phosphate aldolase [Clostridium sp. SYSU GA15002T] |
2.05e-43 | 99 | 70.408 | WP_139904461 |
MULTISPECIES: fructose-6-phosphate aldolase [Listeria] |
2.06e-43 | 96 | 72.632 | WP_088811037 |
fructose-6-phosphate aldolase [Listeria sp. ILCC792] |
2.08e-43 | 96 | 72.632 | WP_088839385 |
MULTISPECIES: fructose-6-phosphate aldolase [Anaerostipes] transaldolase [Anaerostipes caccae] fructose-6-phosphate aldolase [Anaerostipes sp. AF04-45] probable transaldolase [Anaerostipes sp. CAG:276] |
2.13e-43 | 99 | 72.449 | WP_009289078 |
transaldolase [Clostridium butyricum] |
2.15e-43 | 99 | 68.367 | KQB77402 |
transaldolase, partial [Listeria innocua FSL S4-378] |
2.25e-43 | 96 | 74.737 | EFR89433 |
fructose-6-phosphate aldolase [Clostridium butyricum] |
2.32e-43 | 99 | 68.367 | MUO75942 |
MULTISPECIES: fructose-6-phosphate aldolase [unclassified Lachnospiraceae] transaldolase [Lachnospiraceae bacterium NE2001] |
2.32e-43 | 99 | 69.388 | WP_027441092 |
MULTISPECIES: fructose-6-phosphate aldolase [unclassified Clostridium] probable transaldolase 1 [Clostridium sp. CAG:91] fructose-6-phosphate aldolase [Lachnospiraceae bacterium] fructose-6-phosphate aldolase [Clostridium sp. AF46-9NS] fructose-6-phosphate aldolase [Clostridium sp. AF36-18BH] fructose-6-phosphate aldolase [Clostridium sp. AF34-10BH] |
2.37e-43 | 99 | 73.469 | WP_022312177 |
fructose-6-phosphate aldolase [Selenomonas sp. FOBRC9] |
2.49e-43 | 99 | 71.429 | WP_037351104 |
fructose-6-phosphate aldolase [Selenomonas sp. FOBRC9] |
2.53e-43 | 99 | 71.429 | EJP33105 |
MULTISPECIES: fructose-6-phosphate aldolase [Clostridiales] transaldolase [[Clostridium] celerecrescens] fructose-6-phosphate aldolase [Clostridium sp. WB02_MRS01] Transaldolase [Clostridium sp. C105KSO15] fructose-6-phosphate aldolase [Lachnoclostridium sp.] |
2.56e-43 | 99 | 72.449 | WP_038282897 |
MULTISPECIES: fructose-6-phosphate aldolase [Firmicutes] fructose-6-phosphate aldolase [Firmicutes bacterium CAG:65_45_313] probable transaldolase 1 [Firmicutes bacterium CAG:65] Transaldolase [uncultured Clostridium sp.] fructose-6-phosphate aldolase [Lachnospiraceae bacterium] fructose-6-phosphate aldolase [Lachnospiraceae bacterium WCA3-601-WT-6H] |
2.61e-43 | 99 | 73.469 | WP_022154675 |
fructose-6-phosphate aldolase [Clostridium sp. PI-S10-A1B] fructose-6-phosphate aldolase [Clostridium sp. PI-S10-A1B] |
2.85e-43 | 99 | 71.429 | WP_117417339 |
fructose-6-phosphate aldolase [Clostridium butyricum] putative transaldolase [Clostridium butyricum] putative transaldolase [Clostridium butyricum] |
2.94e-43 | 99 | 68.367 | WP_035761621 |
fructose-6-phosphate aldolase [Clostridium ventriculi] Transaldolase [Clostridium ventriculi] |
2.98e-43 | 99 | 69.388 | WP_112366048 |
fructose-6-phosphate aldolase [[Desulfotomaculum] guttoideum] transaldolase [[Desulfotomaculum] guttoideum] |
3.11e-43 | 99 | 72.449 | WP_092247930 |
probable transaldolase [Roseburia sp. CAG:303] |
3.18e-43 | 99 | 71.429 | CDE54259 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_21 In bact CP040530.1
Seq (len = 33 ):
ADAALYFRTSSDYGCHYRHRSRGECPQCFCDDH
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|100438|1|2400005-2400104
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.6295485955775497
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_22 In bact CP040530.1
Seq (len = 146 ):
MEDFLKFLLIAGVILVGIFKEVSKNNKSKKAQNKRPVPPAPSPVEVDPDAIPIPEFWGRGSRALDELLQPIPMEQPAPKPTPKKKKKEEVSVAASIANSSAQDKRNTKQGSHYDHPEPAGEEDFSIHSVEEARRAIIWGEILQRKY
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|464461|-1|1386611-1387055
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
4.970494474573422
unique PSMS
7
unique PSMS
7
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
ferrichrome ABC transporter substrate-binding protein [Bacteroides congonensis]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Hypothetical protein BT_3193a [Bacteroides thetaiotaomicron VPI-5482] hypothetical protein Btheta7330_05112 [Bacteroides thetaiotaomicron] hypothetical protein BSIG_1481 [Bacteroides thetaiotaomicron] Uncharacterised protein [Bacteroides thetaiotaomicron] |
1.09e-100 | 100 | 100.000 | ADX07088 |
Uncharacterised protein [Bacteroides thetaiotaomicron] Uncharacterised protein [Bacteroides thetaiotaomicron] |
3.06e-100 | 100 | 99.315 | CUQ04570 |
hypothetical protein SAMN05216253_11298 [Bacteroides thetaiotaomicron] |
5.25e-100 | 100 | 98.630 | SEG48022 |
hypothetical protein SAMN02910322_03280 [Bacteroides thetaiotaomicron] |
9.49e-100 | 100 | 98.630 | SEL76201 |
hypothetical protein C799_03561 [Bacteroides thetaiotaomicron dnLKV9] |
4.94e-92 | 100 | 87.821 | EOR99679 |
putative uncharacterized protein [Bacteroides thetaiotaomicron CAG:40] |
5.34e-92 | 100 | 87.821 | CDE79304 |
hypothetical protein HMPREF2534_01299 [Bacteroides thetaiotaomicron] hypothetical protein EH213_00542 [Bacteroides thetaiotaomicron] Uncharacterised protein [Bacteroides thetaiotaomicron] hypothetical protein SAMN02910431_01484 [Bacteroides sp. AR20] |
2.56e-91 | 100 | 87.179 | KXT41652 |
Uncharacterised protein [Bacteroides thetaiotaomicron] |
4.11e-90 | 100 | 86.538 | CUP19871 |
conserved hypothetical protein [Bacteroides sp. 1_1_14] |
2.61e-85 | 100 | 94.521 | EFI02996 |
hypothetical protein [Bacteroides faecis] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. HMSC067B03] putative uncharacterized protein [Bacteroides faecis CAG:32] hypothetical protein SAMN05444400_108107 [Bacteroides faecis MAJ27] ferrichrome ABC transporter substrate-binding protein [Bacteroides faecis] ferrichrome ABC transporter substrate-binding protein [Bacteroides faecis] |
3.91e-77 | 100 | 80.795 | WP_010535943 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. HMSC068A09] Uncharacterised protein [Bacteroides thetaiotaomicron] |
1.82e-76 | 100 | 78.710 | OFK45443 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] hypothetical protein SAMN05192581_104312 [Bacteroides ovatus] |
9.77e-68 | 100 | 68.790 | WP_074559254 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides congonensis] |
1.1e-61 | 100 | 62.963 | WP_073347019 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] |
1.9e-60 | 100 | 72.078 | WP_130056948 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein M080_5541 [Bacteroides fragilis str. 3397 T10] conserved hypothetical protein [Bacteroides sp. D22] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. AM16-13] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
3.04e-60 | 100 | 71.429 | WP_009040695 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BSGG_2435 [Bacteroides sp. D2] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. OM05-10AA] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. AF27-33] hypothetical protein SAMN05192582_107110 [Bacteroides ovatus] |
1.84e-59 | 100 | 68.944 | WP_009001353 |
MULTISPECIES: ferrichrome ABC transporter substrate-binding protein [unclassified Bacteroides] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. AF26-7BH] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. OF02-3LB] |
4.25e-59 | 100 | 68.790 | WP_117933385 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
4.3e-59 | 100 | 70.779 | WP_151922308 |
MULTISPECIES: ferrichrome ABC transporter substrate-binding protein [unclassified Bacteroides] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. HF-5141] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. HF-5092] |
6.6e-59 | 100 | 70.779 | WP_143258784 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] |
6.95e-59 | 100 | 68.790 | WP_115484389 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
1.04e-58 | 100 | 70.779 | WP_118407998 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] |
1.8e-58 | 100 | 68.790 | WP_149991842 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BSCG_01685 [Bacteroides sp. 2_2_4] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] |
2.1e-58 | 100 | 68.790 | WP_008775391 |
ferrichrome ABC transporter substrate-binding protein [Escherichia coli] |
2.12e-58 | 100 | 68.153 | MSE90611 |
MULTISPECIES: hypothetical protein [Bacteroides] conserved hypothetical protein [Bacteroides ovatus SD CMC 3f] hypothetical protein HMPREF1017_00452 [Bacteroides ovatus 3_8_47FAA] hypothetical protein HMPREF1069_04780 [Bacteroides ovatus CL02T12C04] hypothetical protein HMPREF1070_00624 [Bacteroides ovatus CL03T12C18] hypothetical protein M088_0134 [Bacteroides ovatus str. 3725 D1 iv] hypothetical protein M082_2025 [Bacteroides fragilis str. 3725 D9 ii] hypothetical protein M089_3388 [Bacteroides ovatus str. 3725 D9 iii] ferrichrome ABC transporter substrate-binding protein [Parabacteroides distasonis] hypothetical protein BXY_23320 [Bacteroides xylanisolvens XB1A] uncharacterized protein BN541_00041 [Bacteroides ovatus CAG:22] |
2.12e-58 | 100 | 68.790 | WP_004302860 |
MULTISPECIES: ferrichrome ABC transporter substrate-binding protein [Bacteroides] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. AF32-8BH] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] |
1.57e-57 | 100 | 68.153 | WP_117513322 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
2.56e-57 | 100 | 69.481 | WP_121960407 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
3.46e-57 | 100 | 68.153 | WP_151923253 |
MULTISPECIES: hypothetical protein [Bacteroides] conserved hypothetical protein [Bacteroides xylanisolvens SD CC 2a] conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein BSAG_00413 [Bacteroides sp. D1] hypothetical protein HMPREF0102_00662 [Bacteroides sp. 2_1_22] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
3.87e-57 | 100 | 69.481 | WP_004312850 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
8.33e-57 | 100 | 68.831 | WP_117683624 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
2.33e-56 | 100 | 68.831 | WP_151935115 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF1074_02623 [Bacteroides xylanisolvens CL03T12C04] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. AM54-2NS] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. AM37-9] |
2.49e-56 | 100 | 68.831 | WP_008023697 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] |
2.81e-56 | 100 | 70.779 | WP_149922286 |
MULTISPECIES: ferrichrome ABC transporter substrate-binding protein [Bacteroides] ferrichrome ABC transporter substrate-binding protein [Bacteroides caecimuris] ferrichrome ABC transporter substrate-binding protein [Bacteroides caecimuris] ferrichrome ABC transporter substrate-binding protein [Bacteroides caecimuris] ferrichrome ABC transporter substrate-binding protein [Bacteroides caecimuri] |
3.18e-56 | 100 | 62.346 | WP_065539925 |
MULTISPECIES: hypothetical protein [Bacteria] hypothetical protein BACCAC_01399 [Bacteroides caccae ATCC 43185] hypothetical protein HMPREF1061_03166 [Bacteroides caccae CL03T12C61] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. 43_46] uncharacterized protein BN535_03213 [Bacteroides caccae CAG:21] ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] |
3.27e-56 | 100 | 70.779 | WP_005676813 |
hypothetical protein [Bacteroides ovatus] hypothetical protein BACOVA_02894 [Bacteroides ovatus ATCC 8483] hypothetical protein BACOV975_01049 [Bacteroides ovatus V975] hypothetical protein Bovatus_03276 [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] hypothetical protein SAMN05444282_11237 [Bacteroides ovatus] |
4.86e-56 | 100 | 68.182 | WP_004298845 |
hypothetical protein [Bacteroides acidifaciens] |
7.55e-56 | 100 | 60.494 | WP_044653540 |
MULTISPECIES: hypothetical protein [Bacteroides] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] |
8.03e-56 | 100 | 68.182 | WP_049701489 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] |
1.37e-55 | 100 | 68.182 | WP_149983641 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein [Bacteroides ovatus] |
1.91e-55 | 100 | 67.532 | WP_118031969 |
ferrichrome ABC transporter substrate-binding protein [Bacteroidaceae bacterium] |
4.04e-55 | 100 | 68.354 | WP_148367734 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] ferrichrome ABC transporter substrate-binding protein [Bacteroides caccae] |
7.33e-55 | 100 | 70.130 | WP_122134734 |
putative uncharacterized protein [Bacteroides sp. CAG:754] |
2.8e-54 | 100 | 62.987 | CDA83481 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] ferrichrome ABC transporter substrate-binding protein [Bacteroides xylanisolvens] |
3.21e-54 | 100 | 67.532 | WP_087322026 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] |
2.74e-53 | 100 | 55.422 | WP_135039118 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] |
2.74e-53 | 100 | 55.422 | WP_121766024 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] |
3.23e-53 | 100 | 55.090 | WP_136014199 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides acidifaciens] |
5.88e-53 | 100 | 54.762 | WP_148332545 |
hypothetical protein [Bacteroides finegoldii] hypothetical protein BACFIN_08533 [Bacteroides finegoldii DSM 17565] putative uncharacterized protein [Bacteroides finegoldii CAG:203] ferrichrome ABC transporter substrate-binding protein [Bacteroides finegoldii] ferrichrome ABC transporter substrate-binding protein [Bacteroides finegoldii] ferrichrome ABC transporter substrate-binding protein [Bacteroides finegoldii] |
1.25e-47 | 100 | 59.732 | WP_007757184 |
hypothetical protein [Bacteroides finegoldii] hypothetical protein HMPREF1057_02157 [Bacteroides finegoldii CL09T03C10] ferrichrome ABC transporter substrate-binding protein [Bacteroides finegoldii] |
1.77e-47 | 100 | 59.732 | WP_007762700 |
MULTISPECIES: ferrichrome ABC transporter substrate-binding protein [unclassified Bacteroides] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. HF-5287] ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. HF-5300] Uncharacterised protein [uncultured Bacteroides sp.] |
3.06e-47 | 100 | 59.060 | WP_143867259 |
hypothetical protein BN890_36410 [Bacteroides xylanisolvens SD CC 1b] |
9.32e-45 | 90 | 65.468 | CDM06039 |
ferrichrome ABC transporter substrate-binding protein [Parabacteroides distasonis] |
1.04e-44 | 79 | 62.992 | MRY82580 |
ferrichrome ABC transporter substrate-binding protein, partial [Bacteroides ovatus] ferrichrome ABC transporter substrate-binding protein, partial [Bacteroides ovatus] |
3.7e-41 | 77 | 61.789 | WP_149969302 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides sp. KCTC 15687] hypothetical protein KGMB02408_27130 [Bacteroides sp. KCTC 15687] |
3.66e-30 | 100 | 46.154 | WP_125041649 |
ferrichrome ABC transporter substrate-binding protein [Bacteroides bouchesdurhonensis] |
1.43e-29 | 100 | 43.038 | WP_148372703 |
ferrichrome ABC transporter substrate-binding protein, partial [Bacteroides ovatus] |
2.27e-29 | 67 | 66.355 | KAA3983674 |
hypothetical protein [Bacteroides bouchesdurhonensis] |
2.3e-29 | 100 | 43.038 | WP_077155560 |
hypothetical protein [Bacteroides faecichinchillae] ferrichrome ABC transporter substrate-binding protein [Bacteroides faecichinchillae] hypothetical protein SAMN05444349_12859 [Bacteroides faecichinchillae] |
8.39e-26 | 100 | 43.791 | WP_025075516 |
ferrichrome ABC transporter substrate-binding protein, partial [Bacteroides ovatus] |
1.4e-25 | 58 | 62.366 | KAA4181957 |
hypothetical protein HMPREF2531_02045 [Bacteroides intestinalis] |
2.58e-20 | 100 | 41.139 | KXT51257 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein F2Y87_05245 [Bacteroides cellulosilyticus] |
2.64e-20 | 100 | 41.139 | WP_082788047 |
hypothetical protein [Bacteroides cellulosilyticus] hypothetical protein BcellWH2_02867 [Bacteroides cellulosilyticus] hypothetical protein DWZ09_13800 [Bacteroides cellulosilyticus] |
5.27e-20 | 100 | 40.506 | WP_029426379 |
hypothetical protein [Bacteroides reticulotermitis] hypothetical protein JCM10512_4197 [Bacteroides reticulotermitis JCM 10512] |
7.56e-20 | 100 | 42.466 | WP_044164813 |
hypothetical protein [Bacteroides cellulosilyticus] Uncharacterised protein [uncultured Bacteroides sp.] hypothetical protein F2Y70_13710 [Bacteroides cellulosilyticus] hypothetical protein F2Y83_05920 [Bacteroides cellulosilyticus] hypothetical protein F2Y74_11415 [Bacteroides cellulosilyticus] hypothetical protein F2Y53_20925 [Bacteroides cellulosilyticus] |
8.48e-20 | 100 | 40.506 | WP_149926408 |
hypothetical protein [Bacteroides timonensis] |
1.67e-19 | 100 | 40.881 | WP_044268344 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DXB37_05585 [Bacteroides uniformis] hypothetical protein DWY57_17960 [Bacteroides sp. AF25-5LB] hypothetical protein DWY41_16585 [Bacteroides sp. AF25-17LB] |
5.67e-16 | 100 | 38.356 | WP_117599947 |
hypothetical protein [Bacteroides uniformis] hypothetical protein DXD40_11595 [Bacteroides uniformis] hypothetical protein DWX44_14910 [Bacteroides uniformis] |
6.24e-16 | 100 | 38.356 | WP_117689138 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein B5G17_18135 [Bacteroides uniformis] hypothetical protein EYA81_08825 [Bacteroides sp. A1C1] hypothetical protein DXD90_15590 [Bacteroides uniformis] hypothetical protein DW786_19360 [Bacteroides uniformis] hypothetical protein DW947_18105 [Bacteroides sp. AM44-19] |
6.52e-16 | 100 | 38.356 | WP_044468396 |
hypothetical protein [Bacteroides uniformis] Uncharacterised protein [Bacteroides uniformis] |
6.66e-16 | 100 | 38.356 | WP_057097306 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DXC07_08895 [Bacteroides uniformis] hypothetical protein DWZ03_07840 [Bacteroides sp. AF29-11] |
7.91e-16 | 100 | 38.356 | WP_117749277 |
hypothetical protein [Bacteroides uniformis] hypothetical protein DWW14_18720 [Bacteroides uniformis] hypothetical protein DWV99_12885 [Bacteroides uniformis] |
8.63e-16 | 100 | 38.356 | WP_117866681 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF0969_01652 [Bacteroides sp. D20] hypothetical protein DXC91_18105 [Bacteroides uniformis] hypothetical protein DXC14_17230 [Bacteroides sp. D20] hypothetical protein DWW83_14685 [Bacteroides uniformis] hypothetical protein DW185_06275 [Bacteroides uniformis] |
1e-15 | 100 | 38.356 | WP_009037536 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein [Bacteroides uniformis] hypothetical protein BHV79_15050 [Bacteroides uniformis] hypothetical protein DXA58_14810 [Bacteroides uniformis] hypothetical protein DW795_02475 [Bacteroides uniformis] hypothetical protein DW216_07600 [Bacteroides uniformis] |
1.04e-15 | 100 | 38.356 | WP_057254107 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BACUNI_00512 [Bacteroides uniformis ATCC 8492] hypothetical protein HMPREF1073_03185 [Bacteroides uniformis CL03T12C37] hypothetical protein HMPREF1072_01374 [Bacteroides uniformis CL03T00C23] hypothetical protein C801_00446 [Bacteroides uniformis dnLKV2] hypothetical protein M094_3051 [Bacteroides uniformis str. 3978 T3 ii] hypothetical protein M093_0441 [Bacteroides uniformis str. 3978 T3 i] uncharacterized protein BN594_00105 [Bacteroides uniformis CAG:3] Uncharacterised protein [Catenibacterium mitsuokai] |
1.12e-15 | 100 | 38.356 | WP_005825277 |
hypothetical protein [Bacteroides sp. AF34-31BH] hypothetical protein DWZ67_18900 [Bacteroides sp. AF34-31BH] hypothetical protein [Bacteroides uniformis] |
1.39e-15 | 100 | 38.356 | WP_120139496 |
hypothetical protein [Bacteroides uniformis] hypothetical protein DWY92_04785 [Bacteroides uniformis] hypothetical protein DWX51_09200 [Bacteroides uniformis] hypothetical protein DW861_18220 [Bacteroides uniformis] hypothetical protein DW771_12660 [Bacteroides uniformis] hypothetical protein DW770_08930 [Bacteroides uniformis] |
2.09e-15 | 100 | 37.671 | WP_117965051 |
hypothetical protein [Bacteroides rodentium] |
6.97e-15 | 100 | 37.671 | WP_025834631 |
hypothetical protein [Bacteroides sp. NM69_E16B] hypothetical protein E5355_03090 [Bacteroides sp. NM69_E16B] |
5.74e-14 | 100 | 39.041 | WP_136009142 |
hypothetical protein [Bacteroides cellulosilyticus] |
1.71e-13 | 100 | 41.139 | WP_129615810 |
uncharacterized protein BN744_01097 [Bacteroides sp. CAG:633] |
1.74e-13 | 100 | 36.478 | CDB09761 |
hypothetical protein [Bacteroides ndongoniae] |
1.87e-13 | 100 | 32.075 | WP_071148564 |
putative uncharacterized protein [Bacteroides cellulosilyticus CAG:158] |
2.3e-13 | 100 | 41.139 | CDB69767 |
hypothetical protein [Bacteroides uniformis] |
2.68e-13 | 100 | 35.616 | HCF77036 |
hypothetical protein BACCELL_02095 [Bacteroides cellulosilyticus DSM 14838] |
3.86e-13 | 100 | 40.506 | EEF90279 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DWX97_13050 [Bacteroides cellulosilyticus] |
4.19e-13 | 100 | 40.506 | WP_026366952 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DXC20_02015 [Bacteroides sp. OM08-17BH] hypothetical protein DW121_03440 [Bacteroides sp. AM10-21B] hypothetical protein [Bacteroides sp.] |
5.36e-13 | 100 | 39.456 | WP_117710487 |
hypothetical protein [Bacteroides cellulosilyticus] hypothetical protein F2Y86_23535 [Bacteroides cellulosilyticus] hypothetical protein EAJ01_23555 [Bacteroides cellulosilyticus] |
6.09e-13 | 100 | 39.873 | WP_149950516 |
hypothetical protein [Bacteroides clarus] hypothetical protein B5F24_03930 [Bacteroides clarus] hypothetical protein DWX38_02660 [Bacteroides clarus] |
7.16e-13 | 100 | 40.136 | WP_087412194 |
hypothetical protein [Bacteroides cellulosilyticus] hypothetical protein HMPREF1062_01671 [Bacteroides cellulosilyticus CL02T12C19] hypothetical protein F2Y81_18355 [Bacteroides cellulosilyticus] hypothetical protein AA416_00908 [Bacteroides cellulosilyticus] hypothetical protein [Bacteroides cellulosilyticus] |
8.12e-13 | 100 | 39.873 | WP_007216456 |
hypothetical protein [Bacteroides neonati] |
9.36e-13 | 100 | 35.714 | WP_042366346 |
hypothetical protein [Bacteroides clarus] hypothetical protein DWW16_01645 [Bacteroides clarus] hypothetical protein DWW09_00815 [Bacteroides clarus] |
1.05e-12 | 100 | 40.136 | WP_118045412 |
hypothetical protein [Bacteroides zoogleoformans] hypothetical protein C4H11_09750 [Bacteroides zoogleoformans] hypothetical protein JN06_00467 [Bacteroides zoogleoformans] |
1.11e-12 | 100 | 34.899 | WP_106041583 |
hypothetical protein [Bacteroides stercoris] |
1.15e-12 | 100 | 40.136 | WP_129618550 |
hypothetical protein [Bacteroides cellulosilyticus] hypothetical protein DWW88_00795 [Bacteroides cellulosilyticus] |
1.17e-12 | 100 | 39.873 | WP_118434277 |
hypothetical protein [Bacteroides clarus] |
2.19e-12 | 100 | 40.136 | WP_148360105 |
hypothetical protein [Bacteroides clarus] conserved domain protein [Bacteroides clarus YIT 12056] hypothetical protein SAMN05444376_2047 [Bacteroides clarus YIT 12056] |
2.92e-12 | 100 | 39.456 | WP_009122001 |
hypothetical protein [Bacteroides intestinalis] uncharacterized protein BN711_00646 [Bacteroides intestinalis CAG:564] hypothetical protein DXK01_005120 [Bacteroides intestinalis] hypothetical protein DXD57_12305 [Bacteroides intestinalis] hypothetical protein DWX27_14470 [Bacteroides intestinalis] hypothetical protein DXA61_01610 [Bacteroides intestinalis] |
2.92e-12 | 100 | 39.241 | WP_021967236 |
hypothetical protein BACINT_01063 [Bacteroides intestinalis DSM 17393] |
3.26e-12 | 100 | 39.241 | EDV05978 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein F3B37_08140 [Bacteroides intestinalis] hypothetical protein F3B35_17275 [Bacteroides intestinalis] hypothetical protein DXD27_12250 [Bacteroides intestinalis] hypothetical protein DW715_06190 [Bacteroides intestinalis] hypothetical protein DW182_11760 [Bacteroides sp. AM16-24] |
3.54e-12 | 100 | 39.241 | WP_044154784 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_23 In bact CP040530.1
Seq (len = 134 ):
MAVLTLSLTSCEVEIDSFYDDDNIGGGYYNRSSDLCSRTWVSFYRDVDGNRCRQELDFYLDRTGVDFIRVEYPNGHVETFEYYFRWNWENYAQTSIRMDYGRNDVSYLDDVYIGGNRLSGYLDGRNNFVEYTGR
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|313882|-1|5111119-5111566
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
6.869988050328095
unique PSMS
7
unique PSMS
7
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein Btheta7330_02862 [Bacteroides thetaiotaomicron] conserved hypothetical protein [Bacteroides sp. 1_1_14] hypothetical protein C799_01469 [Bacteroides thetaiotaomicron dnLKV9] putative uncharacterized protein [Bacteroides thetaiotaomicron CAG:40] hypothetical protein SAMN02910431_02255 [Bacteroides sp. AR20] |
7.76e-92 | 100 | 100.000 | ALJ42401 |
putative lipoprotein [Bacteroides thetaiotaomicron] putative lipoprotein [Bacteroides thetaiotaomicron] |
1.87e-91 | 100 | 99.254 | CUP68734 |
hypothetical protein [Bacteroides faecis] putative uncharacterized protein [Bacteroides faecis CAG:32] |
4.55e-90 | 100 | 97.761 | WP_022302243 |
hypothetical protein [Bacteroides faecis] hypothetical protein HMPREF2815_19575 [Bacteroides sp. HMSC068A09] hypothetical protein HMPREF2794_01890 [Bacteroides sp. HMSC067B03] putative lipoprotein [Bacteroides thetaiotaomicron] hypothetical protein SAMN05444400_103186 [Bacteroides faecis MAJ27] hypothetical protein F2Z41_04025 [Bacteroides faecis] |
1.21e-88 | 100 | 97.015 | WP_010537764 |
hypothetical protein [Bacteroides ovatus] hypothetical protein HMPREF1070_04645 [Bacteroides ovatus CL03T12C18] hypothetical protein F3D65_26300 [Bacteroides ovatus] hypothetical protein F3D72_06700 [Bacteroides ovatus] hypothetical protein F3F40_08610 [Bacteroides ovatus] hypothetical protein F3D58_06620 [Bacteroides ovatus] |
4.63e-78 | 100 | 84.328 | WP_004326916 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] conserved hypothetical protein [Bacteroides sp. 3_1_23] hypothetical protein DWY71_02685 [Bacteroides sp. AF26-7BH] hypothetical protein DXA46_04535 [Bacteroides sp. OF02-3LB] |
1.42e-77 | 100 | 83.582 | WP_008647198 |
MULTISPECIES: hypothetical protein [Bacteroides] putative lipoprotein [Bacteroides ovatus SD CMC 3f] putative lipoprotein [Bacteroides ovatus CAG:22] hypothetical protein F3F61_03155 [Bacteroides ovatus] hypothetical protein F3B68_05145 [Bacteroides ovatus] hypothetical protein F3C56_00330 [Bacteroides ovatus] |
1.42e-77 | 100 | 83.582 | WP_004310735 |
MULTISPECIES: hypothetical protein [Bacteroidales] hypothetical protein HMPREF1017_03866 [Bacteroides ovatus 3_8_47FAA] hypothetical protein HMPREF1069_01160 [Bacteroides ovatus CL02T12C04] hypothetical protein GAS36_24565 [Bacteroides vulgatus] hypothetical protein BSGG_0431 [Bacteroides sp. D2] hypothetical protein F3F42_07590 [Bacteroides ovatus] |
1.89e-77 | 100 | 83.582 | WP_004306378 |
MULTISPECIES: hypothetical protein [Bacteroides] putative lipoprotein [Bacteroides sp. CAG:754] |
3.16e-77 | 100 | 84.328 | WP_022137752 |
hypothetical protein [Bacteroides ovatus] hypothetical protein BACOVA_00519 [Bacteroides ovatus ATCC 8483] hypothetical protein BACOV975_03147 [Bacteroides ovatus V975] hypothetical protein Bovatus_00347 [Bacteroides ovatus] hypothetical protein C5Z02_08395 [Bacteroides ovatus] hypothetical protein DWX70_10290 [Bacteroides ovatus] |
3.37e-77 | 100 | 83.582 | WP_004297847 |
hypothetical protein [Bacteroides finegoldii] hypothetical protein HMPREF1057_00709 [Bacteroides finegoldii CL09T03C10] |
3.93e-77 | 100 | 84.328 | WP_007759624 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein GD630_01785 [Bacteroides sp. HF-5287] hypothetical protein FOJ72_00415 [Bacteroides sp. HF-5300] Uncharacterised protein [uncultured Bacteroides sp.] |
6.1e-77 | 100 | 84.328 | WP_143864594 |
MULTISPECIES: hypothetical protein [Bacteroides] putative lipoprotein [Bacteroides fragilis str. 3725 D9 ii] putative lipoprotein [Bacteroides ovatus str. 3725 D1 iv] putative lipoprotein [Bacteroides ovatus str. 3725 D9 iii] hypothetical protein HMPREF3015_22680 [Bacteroides sp. HMSC073E02] hypothetical protein DYI28_04980 [Bacteroides ovatus] |
6.24e-77 | 100 | 82.836 | WP_032845977 |
MULTISPECIES: hypothetical protein [Bacteroides] putative lipoprotein [Bacteroides xylanisolvens SD CC 2a] putative lipoprotein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein HMPREF1074_01322 [Bacteroides xylanisolvens CL03T12C04] hypothetical protein BSAG_01300 [Bacteroides sp. D1] hypothetical protein HMPREF0102_02725 [Bacteroides sp. 2_1_22] |
6.74e-77 | 100 | 82.836 | WP_004316335 |
hypothetical protein [Bacteroidaceae bacterium] |
7.11e-77 | 100 | 82.836 | WP_148367336 |
hypothetical protein [Bacteroides sp. AM56-10ce] hypothetical protein DXA11_02195 [Bacteroides sp. AM56-10ce] |
8.39e-77 | 100 | 82.836 | WP_128131197 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein F3D71_29330 [Bacteroides ovatus] hypothetical protein BXY_09030 [Bacteroides xylanisolvens XB1A] hypothetical protein BSCG_02715 [Bacteroides sp. 2_2_4] conserved hypothetical protein [Bacteroides sp. D22] hypothetical protein HMPREF0127_03672 [Bacteroides sp. 1_1_30] |
9.36e-77 | 100 | 82.836 | WP_008644218 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein GD631_05475 [Bacteroides sp. HF-5141] hypothetical protein FNW54_05465 [Bacteroides sp. HF-5092] |
1.03e-76 | 100 | 82.836 | WP_143257527 |
hypothetical protein [Bacteroides ovatus] hypothetical protein F3F30_10620 [Bacteroides ovatus] hypothetical protein F3F24_13505 [Bacteroides ovatus] hypothetical protein F3D74_10865 [Bacteroides ovatus] hypothetical protein F3F38_26960 [Bacteroides ovatus] hypothetical protein [Bacteroides ovatus] |
1.14e-76 | 100 | 82.836 | WP_149946869 |
hypothetical protein [Bacteroides ovatus] hypothetical protein [Escherichia coli] hypothetical protein F3F97_18450 [Bacteroides ovatus] hypothetical protein F3F64_23550 [Bacteroides ovatus] hypothetical protein F3F51_11585 [Bacteroides ovatus] hypothetical protein F3F87_11075 [Bacteroides ovatus] |
1.36e-76 | 100 | 82.836 | WP_149939347 |
hypothetical protein BHV74_10645 [Bacteroides finegoldii] |
2.62e-76 | 100 | 83.582 | OKZ21978 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein DW042_15865 [Bacteroides xylanisolvens] |
3.03e-76 | 100 | 82.836 | WP_118408093 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein DXB58_21300 [Bacteroides sp. OM05-10AA] hypothetical protein DWY87_21660 [Bacteroides sp. AF27-33] |
3.09e-76 | 100 | 82.836 | WP_122138205 |
hypothetical protein [Bacteroides caccae] hypothetical protein F2Y27_07405 [Bacteroides caccae] hypothetical protein F2Y25_05425 [Bacteroides caccae] hypothetical protein F2Y35_05985 [Bacteroides caccae] hypothetical protein F2Y47_05195 [Bacteroides caccae] |
9.47e-76 | 99 | 84.211 | WP_149927925 |
hypothetical protein [Bacteroides finegoldii] hypothetical protein BACFIN_07152 [Bacteroides finegoldii DSM 17565] putative uncharacterized protein [Bacteroides finegoldii CAG:203] hypothetical protein F2Z28_16790 [Bacteroides finegoldii] hypothetical protein F2Z16_16750 [Bacteroides finegoldii] hypothetical protein F2Z20_17560 [Bacteroides finegoldii] |
1.02e-75 | 100 | 83.582 | WP_007753917 |
hypothetical protein [Bacteroides caccae] hypothetical protein BACCAC_01067 [Bacteroides caccae ATCC 43185] hypothetical protein HMPREF1061_01353 [Bacteroides caccae CL03T12C61] hypothetical protein BHV72_02140 [Bacteroides sp. 43_46] uncharacterized protein BN535_02242 [Bacteroides caccae CAG:21] hypothetical protein CGC64_11280 [Bacteroides caccae] |
1.09e-75 | 99 | 84.211 | WP_005676429 |
hypothetical protein [Bacteroides acidifaciens] hypothetical protein D7V84_20290 [Bacteroides acidifaciens] hypothetical protein D7Y07_19300 [Bacteroides acidifaciens] hypothetical protein E4T97_15570 [Bacteroides acidifaciens] hypothetical protein E5356_04200 [Bacteroides acidifaciens] |
1.42e-75 | 100 | 82.836 | WP_024987887 |
hypothetical protein [Bacteroides caccae] hypothetical protein DW254_07125 [Bacteroides caccae] |
5.3e-75 | 99 | 83.459 | WP_122270990 |
hypothetical protein [Bacteroides caccae] hypothetical protein DW706_03260 [Bacteroides caccae] |
5.36e-75 | 99 | 83.459 | WP_122364839 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein A4V03_06985 [Bacteroides caecimuris] hypothetical protein ADH74_09255 [Bacteroides caecimuris] hypothetical protein D7W50_05255 [Bacteroides caecimuris] hypothetical protein E5353_04005 [Bacteroides caecimuri] |
3.82e-74 | 100 | 82.090 | WP_065538422 |
hypothetical protein [Bacteroides sp. KCTC 15687] hypothetical protein KGMB02408_14820 [Bacteroides sp. KCTC 15687] |
1.38e-73 | 100 | 81.343 | WP_125040718 |
hypothetical protein [Bacteroides faecichinchillae] hypothetical protein E5981_13970 [Bacteroides faecichinchillae] hypothetical protein SAMN05444349_12054 [Bacteroides faecichinchillae] |
1.12e-71 | 100 | 79.851 | WP_073349948 |
hypothetical protein [Bacteroides bouchesdurhonensis] |
2.16e-71 | 100 | 79.104 | WP_077154482 |
hypothetical protein JCM6292_2675 [Bacteroides pyogenes JCM 6292] |
8.88e-70 | 100 | 74.627 | GAE16273 |
hypothetical protein [Bacteroides pyogenes] hypothetical protein FNJ60_08725 [Bacteroides pyogenes] hypothetical protein FNJ61_08590 [Bacteroides pyogenes] hypothetical protein FNJ59_07750 [Bacteroides pyogenes] hypothetical protein FNG97_08095 [Bacteroides pyogenes] |
9.28e-70 | 100 | 74.627 | WP_027325627 |
hypothetical protein [Bacteroides reticulotermitis] hypothetical protein JCM10512_2820 [Bacteroides reticulotermitis JCM 10512] |
1.64e-69 | 99 | 77.444 | WP_044163111 |
hypothetical protein [Bacteroides pyogenes] hypothetical protein HMPREF1981_01343 [Bacteroides pyogenes F0041] hypothetical protein JCM10003_1518 [Bacteroides pyogenes JCM 10003] Uncharacterised protein [Bacteroides pyogenes] |
9.69e-69 | 100 | 73.134 | WP_021644705 |
uncharacterized protein BN523_01944 [Bacteroides sp. CAG:189] |
3.83e-55 | 100 | 61.940 | CCY49376 |
hypothetical protein [Bacteroides salyersiae] hypothetical protein GAA62_19720 [Bacteroides salyersiae] hypothetical protein GAA37_19385 [Bacteroides salyersiae] hypothetical protein F9967_10440 [Bacteroides salyersiae] hypothetical protein GAA00_18910 [Bacteroides salyersiae] hypothetical protein GAA13_19255 [Bacteroides salyersiae] |
4.18e-55 | 100 | 61.940 | WP_055295050 |
hypothetical protein [Bacteroides fragilis] hypothetical protein HMPREF1205_03373 [Bacteroides fragilis HMW 616] hypothetical protein IB64_013625 [Bacteroides fragilis] hypothetical protein DXA27_15915 [Bacteroides fragilis] |
1.38e-54 | 99 | 66.165 | WP_005819635 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BFAG_01136 [Bacteroides fragilis 3_1_12] putative uncharacterized protein [Bacteroides fragilis CAG:558] hypothetical protein BUN20_06185 [Bacteroides fragilis] hypothetical protein AOQ65_07570 [Bacteroides fragilis] hypothetical protein AE749_16210 [Bacteroides fragilis] |
2.18e-54 | 99 | 65.414 | WP_005776592 |
hypothetical protein [Bacteroides salyersiae] hypothetical protein F3F90_18430 [Bacteroides salyersiae] hypothetical protein F3F88_15480 [Bacteroides salyersiae] hypothetical protein F3F89_12070 [Bacteroides salyersiae] hypothetical protein F3F83_07180 [Bacteroides salyersiae] hypothetical protein F3G06_02825 [Bacteroides salyersiae] |
2.23e-54 | 100 | 61.194 | WP_130058736 |
hypothetical protein [Bacteroides salyersiae] hypothetical protein HMPREF1071_02674 [Bacteroides salyersiae CL02T12C01] hypothetical protein HMPREF1532_00029 [Bacteroides salyersiae WAL 10018 = DSM 18765 = JCM 12988] |
2.28e-54 | 100 | 61.194 | WP_005923119 |
hypothetical protein [Bacteroides nordii] hypothetical protein HMPREF1068_02062 [Bacteroides nordii CL02T12C05] hypothetical protein DW888_12435 [Bacteroides nordii] |
6.96e-54 | 100 | 62.687 | WP_007485163 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein [Bacteroides fragilis YCH46] hypothetical protein HMPREF1067_02801 [Bacteroides fragilis CL03T12C07] hypothetical protein HMPREF1066_01753 [Bacteroides fragilis CL03T00C08] hypothetical protein HMPREF1204_03618 [Bacteroides fragilis HMW 615] hypothetical protein M101_1691 [Bacteroides fragilis str. 1007-1-F #8] hypothetical protein M077_5034 [Bacteroides fragilis str. 2-F-2 #5] hypothetical protein M078_3868 [Bacteroides fragilis str. 2-F-2 #7] hypothetical protein M080_4390 [Bacteroides fragilis str. 3397 T10] hypothetical protein M117_1662 [Bacteroides fragilis str. 3774 T13] hypothetical protein M118_4837 [Bacteroides fragilis str. 3783N1-2] hypothetical protein M121_1602 [Bacteroides fragilis str. 3783N2-1] hypothetical protein M111_1585 [Bacteroides fragilis str. 3986T(B)10] hypothetical protein M085_1592 [Bacteroides fragilis str. 3986 N(B)19] hypothetical protein M083_1823 [Bacteroides fragilis str. 3986 T(B)9] hypothetical protein M124_1568 [Bacteroides fragilis str. 3988T(B)14] hypothetical protein M079_1829 [Bacteroides fragilis str. 3996 N(B) 6] hypothetical protein M125_2255 [Bacteroides fragilis str. 3998T(B)3] hypothetical protein M081_1964 [Bacteroides fragilis str. 3998 T(B) 4] hypothetical protein M072_1672 [Bacteroides fragilis str. DS-208] hypothetical protein M073_1705 [Bacteroides fragilis str. DS-71] hypothetical protein M067_1912 [Bacteroides fragilis str. J-143-4] hypothetical protein M136_1848 [Bacteroides fragilis str. S36L11] hypothetical protein M147_1806 [Bacteroides fragilis str. 1007-1-F #4] hypothetical protein M100_1768 [Bacteroides fragilis str. 1007-1-F #7] hypothetical protein M076_1801 [Bacteroides fragilis str. 2-F-2 #4] hypothetical protein M109_2068 [Bacteroides fragilis str. 3397 N2] hypothetical protein M108_1747 [Bacteroides fragilis str. 3397 T14] hypothetical protein M116_1944 [Bacteroides fragilis str. 3719 A10] hypothetical protein M107_2603 [Bacteroides fragilis str. 3725 D9(v)] hypothetical protein M120_2080 [Bacteroides fragilis str. 3783N1-8] hypothetical protein M123_1938 [Bacteroides fragilis str. 3976T8] hypothetical protein M144_4898 [Bacteroides fragilis str. 3-F-2 #6] hypothetical protein M069_1985 [Bacteroides fragilis str. B1 (UDC16-1)] hypothetical protein M068_1864 [Bacteroides fragilis str. J38-1] hypothetical protein M087_1670 [Bacteroides fragilis str. S23 R14] hypothetical protein M104_3906 [Bacteroides fragilis str. 1007-1-F #10] hypothetical protein M146_2139 [Bacteroides fragilis str. 1007-1-F #3] hypothetical protein M106_2760 [Bacteroides fragilis str. 1009-4-F #10] hypothetical protein M075_2086 [Bacteroides fragilis str. 20793-3] hypothetical protein M110_1810 [Bacteroides fragilis str. 3397 N3] hypothetical protein M115_1718 [Bacteroides fragilis str. 3719 T6] hypothetical protein M112_1822 [Bacteroides fragilis str. 3986 T(B)13] hypothetical protein M070_1742 [Bacteroides fragilis str. A7 (UDC12-2)] hypothetical protein M139_1811 [Bacteroides fragilis str. S23L24] hypothetical protein M132_1680 [Bacteroides fragilis str. S24L15] hypothetical protein M133_1676 [Bacteroides fragilis str. S24L26] hypothetical protein M134_1224 [Bacteroides fragilis str. S24L34] hypothetical protein M137_2379 [Bacteroides fragilis str. S36L12] hypothetical protein M128_1933 [Bacteroides fragilis str. S6L8] hypothetical protein M129_1924 [Bacteroides fragilis str. S6R5] hypothetical protein M119_2069 [Bacteroides fragilis str. 3783N1-6] hypothetical protein M066_4676 [Bacteroides fragilis str. I1345] hypothetical protein M138_1768 [Bacteroides fragilis str. S23L17] hypothetical protein M131_1867 [Bacteroides fragilis str. S6R8] hypothetical protein M148_1850 [Bacteroides fragilis str. 1007-1-F #5] hypothetical protein M149_1984 [Bacteroides fragilis str. 1007-1-F #6] hypothetical protein M113_1814 [Bacteroides fragilis str. 3986 N3] hypothetical protein BF9343_1798 [Bacteroides fragilis NCTC 9343] hypothetical protein BF638R_1850 [Bacteroides fragilis 638R] putative uncharacterized protein [Bacteroides fragilis CAG:47] |
9.56e-54 | 99 | 64.662 | WP_005786789 |
hypothetical protein M145_4322 [Bacteroides fragilis str. 34-F-2 #13] hypothetical protein M122_1554 [Bacteroides fragilis str. 3976T7] hypothetical protein M084_5149 [Bacteroides fragilis str. 3988 T1] hypothetical protein M074_1777 [Bacteroides fragilis str. DS-166] hypothetical protein M071_4504 [Bacteroides fragilis str. Ds-233] hypothetical protein M086_4538 [Bacteroides fragilis str. S13 L11] hypothetical protein M065_2619 [Bacteroides fragilis str. Korea 419] hypothetical protein M126_2080 [Bacteroides fragilis str. S6L3] hypothetical protein M130_1874 [Bacteroides fragilis str. S6R6] hypothetical protein M103_4266 [Bacteroides fragilis str. 1007-1-F #9] hypothetical protein M105_2271 [Bacteroides fragilis str. 1009-4-F #7] hypothetical protein M114_1624 [Bacteroides fragilis str. 3986 N(B)22] hypothetical protein M135_2149 [Bacteroides fragilis str. S36L5] hypothetical protein M141_1690 [Bacteroides fragilis str. S38L5] hypothetical protein M140_1645 [Bacteroides fragilis str. S38L3] hypothetical protein M127_1865 [Bacteroides fragilis str. S6L5] hypothetical protein AC094_18940 [Bacteroides fragilis] |
1.01e-53 | 99 | 64.662 | EXY38457 |
hypothetical protein [Bacteroides fragilis] hypothetical protein HMPREF1203_02251 [Bacteroides fragilis HMW 610] hypothetical protein DXB57_12070 [Bacteroides fragilis] hypothetical protein DXA67_19230 [Bacteroides fragilis] |
1.22e-53 | 99 | 64.662 | WP_005808888 |
hypothetical protein [Bacteroides fragilis] hypothetical protein MB0529_01678 [Bacteroides fragilis] |
4.15e-53 | 99 | 63.910 | WP_053873750 |
hypothetical protein [Bacteroides fragilis] hypothetical protein HMPREF1079_00364 [Bacteroides fragilis CL05T00C42] hypothetical protein HMPREF1080_01836 [Bacteroides fragilis CL05T12C13] hypothetical protein F3B26_16795 [Bacteroides fragilis] |
4.15e-53 | 99 | 63.910 | WP_005800487 |
hypothetical protein [Bacteroides nordii] |
1.21e-52 | 100 | 61.940 | WP_025867659 |
hypothetical protein [Bacteroides sp. HPS0048] hypothetical protein HMPREF1214_02785 [Bacteroides sp. HPS0048] |
1.98e-51 | 100 | 61.194 | WP_002560720 |
hypothetical protein JCM6294_2827 [Bacteroides pyogenes DSM 20611 = JCM 6294] |
3.08e-43 | 70 | 72.340 | GAE19735 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF1534_01062 [Bacteroides massiliensis B84634 = Timone 84634 = DSM 17679 = JCM 13223] putative uncharacterized protein [Bacteroides sp. CAG:98] hypothetical protein DW267_01730 [Bacteroides sp. AM22-3LB] hypothetical protein DW175_08355 [Bacteroides sp. AM16-15] hypothetical protein DW683_06055 [Bacteroides sp. AM25-34] |
9.54e-34 | 91 | 56.098 | WP_005938071 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF1058_03288 [Bacteroides vulgatus CL09T03C04] hypothetical protein [Bacteroides sp.] hypothetical protein BSFG_01132 [Bacteroides sp. 4_3_47FAA] hypothetical protein HMPREF9011_01414 [Bacteroides sp. 3_1_40A] hypothetical protein F2Y61_13500 [Bacteroides dorei] |
4.25e-33 | 99 | 48.872 | WP_005852597 |
hypothetical protein [Bacteroides vulgatus] hypothetical protein DW150_15185 [Bacteroides vulgatus] |
4.3e-33 | 99 | 48.872 | WP_118291459 |
MULTISPECIES: hypothetical protein [Bacteroides] conserved hypothetical protein [Bacteroides vulgatus ATCC 8482] hypothetical protein [Bacteroides sp.] hypothetical protein GAS47_18265 [Bacteroides vulgatus] hypothetical protein GAS37_07015 [Bacteroides vulgatus] hypothetical protein F9Z94_09120 [Bacteroides vulgatus] |
6.16e-33 | 99 | 48.120 | WP_012055714 |
hypothetical protein [Bacteroides vulgatus] hypothetical protein C800_02680 [Bacteroides vulgatus dnLKV7] hypothetical protein DW810_12845 [Bacteroides vulgatus] |
6.5e-33 | 99 | 48.872 | WP_016271191 |
hypothetical protein [Bacteroides vulgatus] hypothetical protein F9001_20385 [Bacteroides vulgatus] hypothetical protein DW193_15335 [Bacteroides vulgatus] uncharacterized protein BN728_02220 [Bacteroides vulgatus CAG:6] putative lipoprotein [Bacteroides vulgatus] |
7.33e-33 | 99 | 48.872 | WP_022508857 |
hypothetical protein [Bacteroides vulgatus] hypothetical protein BHV77_16455 [Bacteroides sp. 43_108] hypothetical protein DWX60_10490 [Bacteroides vulgatus] hypothetical protein DWV27_11140 [Bacteroides vulgatus] |
1.11e-32 | 99 | 48.120 | WP_117829806 |
hypothetical protein [Bacteroides dorei] hypothetical protein BACDOR_02563 [Bacteroides dorei DSM 17855] |
1.15e-32 | 99 | 48.872 | WP_007835173 |
hypothetical protein [Bacteroides dorei] hypothetical protein HMPREF1063_03775 [Bacteroides dorei CL02T00C15] hypothetical protein HMPREF1064_03416 [Bacteroides dorei CL02T12C06] |
1.59e-32 | 99 | 49.624 | WP_007849241 |
MULTISPECIES: hypothetical protein [Bacteroides] conserved hypothetical protein [Bacteroides vulgatus PC510] hypothetical protein M098_1326 [Bacteroides vulgatus str. 3775 SR(B) 19] hypothetical protein M097_2080 [Bacteroides vulgatus str. 3775 SL(B) 10 (iv)] hypothetical protein BvMPK_3004 [Bacteroides vulgatus] hypothetical protein F9Z96_15150 [Bacteroides vulgatus] |
2.07e-32 | 99 | 47.368 | WP_005840010 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein ABI39_17500 [Bacteroides dorei CL03T12C01] hypothetical protein BSEG_02452 [Bacteroides dorei 5_1_36/D4] uncharacterized protein BN543_00996 [Bacteroides dorei CAG:222] hypothetical protein EL88_10140 [Bacteroides dorei] hypothetical protein GV66_18095 [Bacteroides dorei] |
2.11e-32 | 99 | 49.624 | WP_007843200 |
hypothetical protein F3G09_14545, partial [Bacteroides salyersiae] |
1.62e-30 | 66 | 59.551 | KAA3708719 |
hypothetical protein [Bacteroides sartorii] hypothetical protein E5339_00120 [Bacteroides sartorii] |
1.63e-30 | 99 | 50.746 | WP_025018980 |
hypothetical protein [Bacteroides sartorii] hypothetical protein C802_03282 [Bacteroides sartorii] |
4.45e-30 | 93 | 51.181 | WP_016277592 |
hypothetical protein M079_4733, partial [Bacteroides fragilis str. 3996 N(B) 6] |
4.78e-18 | 42 | 66.071 | EXY87450 |
hypothetical protein [Bacteroides plebeius] |
3.52e-15 | 93 | 38.710 | WP_148374636 |
hypothetical protein BACPLE_01127 [Bacteroides plebeius DSM 17135] |
3.87e-15 | 93 | 38.710 | EDY96684 |
hypothetical protein [Bacteroides plebeius] hypothetical protein DXC17_14970 [Bacteroides plebeius] hypothetical protein DXB87_14735 [Bacteroides plebeius] hypothetical protein DWY86_11305 [Bacteroides plebeius] hypothetical protein DWY72_11730 [Bacteroides plebeius] hypothetical protein DW789_12955 [Bacteroides plebeius] |
7.47e-15 | 93 | 38.710 | WP_117702743 |
uncharacterized protein BN612_00163 [Bacteroides coprophilus CAG:333] |
7.46e-14 | 76 | 40.777 | CDC54851 |
hypothetical protein [Bacteroides plebeius] hypothetical protein DW110_04780 [Bacteroides plebeius] |
8.52e-14 | 93 | 37.903 | WP_118337971 |
hypothetical protein [Bacteroides coprophilus] hypothetical protein DW921_07805 [Bacteroides coprophilus] |
9.97e-14 | 76 | 40.777 | WP_118400400 |
hypothetical protein [Bacteroides plebeius] hypothetical protein BHV77_01995 [Bacteroides sp. 43_108] hypothetical protein DXD04_07300 [Bacteroides plebeius] hypothetical protein DWZ34_04350 [Bacteroides plebeius] |
1e-13 | 93 | 37.903 | WP_117672273 |
hypothetical protein [Bacteroides plebeius] hypothetical protein DWY45_08850 [Bacteroides plebeius] hypothetical protein DWY21_06835 [Bacteroides plebeius] hypothetical protein DWY14_07725 [Bacteroides plebeius] hypothetical protein DW982_10585 [Bacteroides plebeius] hypothetical protein DW941_13715 [Bacteroides plebeius] |
1.08e-13 | 93 | 37.903 | WP_118027797 |
hypothetical protein BACCOPRO_00061 [Bacteroides coprophilus DSM 18228 = JCM 13818] |
1.43e-13 | 76 | 40.777 | EEF74602 |
hypothetical protein [Parabacteroides massiliensis] |
3.07e-13 | 70 | 44.211 | WP_075966110 |
putative uncharacterized protein [Bacteroides plebeius CAG:211] |
3.6e-13 | 93 | 37.097 | CCZ88568 |
hypothetical protein [Bacteroidaceae bacterium] Uncharacterised protein [uncultured Bacteroides sp.] |
4.5e-13 | 67 | 42.222 | WP_154044665 |
hypothetical protein [Bacteroides mediterraneensis] |
5.65e-13 | 93 | 37.903 | WP_072543951 |
Uncharacterised protein [uncultured Bacteroides sp.] |
6.45e-13 | 93 | 37.903 | SCH11695 |
hypothetical protein [Bacteroidaceae bacterium] |
7.08e-13 | 93 | 37.903 | WP_148328076 |
hypothetical protein [Parabacteroides merdae] |
8.73e-13 | 87 | 38.983 | MTT26621 |
MULTISPECIES: hypothetical protein [Bacteroidales] hypothetical protein PARMER_01543 [Parabacteroides merdae ATCC 43184] hypothetical protein HMPREF1060_03130 [Parabacteroides merdae CL03T12C32] hypothetical protein HMPREF1078_02400 [Parabacteroides merdae CL09T00C40] hypothetical protein BHV83_03905 [Parabacteroides sp. merdae-related_45_40] uncharacterized protein BN675_01291 [Parabacteroides merdae CAG:48] |
1.04e-12 | 87 | 38.983 | WP_005637519 |
hypothetical protein [Parabacteroides sp. AF17-28] hypothetical protein DWW90_05875 [Parabacteroides sp. AF17-28] |
1.06e-12 | 93 | 36.800 | WP_122344333 |
hypothetical protein [Parabacteroides merdae] hypothetical protein [Parabacteroides merdae] hypothetical protein EAJ15_18170 [Parabacteroides merdae] |
1.12e-12 | 84 | 38.938 | WP_129944052 |
hypothetical protein [Parabacteroides acidifaciens] hypothetical protein DWU89_08530 [Parabacteroides acidifaciens] |
1.24e-12 | 93 | 36.800 | WP_115499230 |
putative uncharacterized protein [Bacteroides sp. CAG:875] |
1.29e-12 | 93 | 37.903 | CDD49520 |
hypothetical protein [Coprobacter fastidiosus] hypothetical protein HMPREF1033_02889 [Tannerella sp. 6_1_58FAA_CT1] hypothetical protein DBY02_05555 [Coprobacter fastidiosus] |
1.86e-12 | 67 | 45.745 | WP_009319386 |
hypothetical protein [Parabacteroides sp. AF48-14] hypothetical protein DW083_04930 [Parabacteroides sp. AF48-14] |
1.91e-12 | 84 | 39.823 | WP_122331636 |
uncharacterized protein BN659_01944 [Bacteroides sp. CAG:443] |
2.49e-12 | 92 | 37.903 | CDB96547 |
hypothetical protein [Coprobacter fastidiosus] hypothetical protein NSB1T_06875 [Coprobacter fastidiosus NSB1] hypothetical protein DW107_05530 [Tannerella sp. AM09-19] hypothetical protein DWV37_02370 [Tannerella sp. AF04-6] putative uncharacterized protein [Tannerella sp. CAG:51] hypothetical protein BC742_2540 [Coprobacter fastidiosus NSB1] |
2.57e-12 | 67 | 45.745 | WP_022390029 |
hypothetical protein [Parabacteroides pacaensis] |
2.86e-12 | 70 | 37.234 | WP_106828329 |
hypothetical protein [Bacteroides sp. An51A] hypothetical protein B5G04_14410 [Bacteroides sp. An51A] |
5.39e-12 | 92 | 37.209 | WP_087397966 |
hypothetical protein [Bacteroides sp. An19] hypothetical protein B5F25_08135 [Bacteroides sp. An19] |
7.59e-12 | 92 | 37.209 | WP_087248901 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein B5F78_09430 [Bacteroides sp. An279] hypothetical protein B5F71_10050 [Bacteroides sp. An269] putative uncharacterized protein [Bacteroides sp. CAG:702] |
7.92e-12 | 92 | 37.209 | WP_022040871 |
hypothetical protein HMPREF1055_01119 [Bacteroides fragilis CL07T00C01] hypothetical protein HMPREF1056_01803 [Bacteroides fragilis CL07T12C05] |
6.03e-11 | 29 | 71.795 | EIK39462 |
hypothetical protein [Bacteroides barnesiae] |
1.67e-10 | 90 | 37.097 | WP_025892563 |
hypothetical protein [Bacteroides salanitronis] hypothetical protein Bacsa_0557 [Bacteroides salanitronis DSM 18170] |
1.93e-10 | 92 | 34.959 | WP_013616612 |
hypothetical protein [Bacteroides fluxus] hypothetical protein HMPREF9446_03434 [Bacteroides fluxus YIT 12057] |
1.99e-10 | 93 | 32.558 | WP_009126648 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_24 In clostri CP040626.1
Seq (len = 15 ):
WTAYSNGYYKNSSMY
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|168751|1|2346232-2346277
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.5512936800949197
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_25 In bact CP040530.1
Seq (len = 65 ):
MSFCDNTVVAAGSSRSFRFSFGVAITTTSSMSTTLRESLGKSSAHVVPVVRSVRAIIIFFVFIRS
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|512796|-1|310719-311007
Transkriptom
91.0% of gene length expressed over median expression of contig.
ŝ
2.1609411558262095
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 91 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_26 In blautia CP039126.1
Seq (len = 28 ):
LSACCCFCLSSHPTTRKAAAAPALTIRA
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|306987|-1|4067005-4067089
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
3.1009094044369894
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_27 In blautia CP039126.1
Seq (len = 294 ):
IGLTQEEIAKRMNMSRQRVNRIVSSCIKLGIVKITIDGMENCYLELENQLEKKFHLKEVCIIENENPDDLYDNLGAEAAQCLMRHVKNNSIIGIARGRAVSSLIENLPIVQNKENITVTQLIGNIKEDNSQLGVDNMVYELASKLHAHEEHLYAPIIVGTAELKNAFMEDKVCKNTYSIIKNSDIAIVGIGAAKKQWKYLMSLYSQEDVRQRRWAKKVVGEVCTYFYDENGNEVEPPFRDRIITVSHNDYKSIPIRIGVAGGVEKLDAIRGAVLGGYINVLVTDKKVAEKLLEN
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|237089|-1|5875683-5876637
Transkriptom
90.0% of gene length expressed over median expression of contig.
ŝ
7.5893577140275585
unique PSMS
8
unique PSMS
8
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
sugar-binding transcriptional regulator [Clostridiales bacterium Marseille-P5551]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
sugar-binding transcriptional regulator [Clostridiales bacterium Marseille-P5551] |
1.55e-110 | 99 | 54.296 | WP_122644771 |
sugar-binding transcriptional regulator [Muricomes intestini] DNA-binding transcriptional regulator LsrR (DeoR family) [Muricomes intestini] transcriptional regulator [Lachnospiraceae bacterium] transcriptional regulator [Lachnospiraceae bacterium] |
1.81e-104 | 99 | 51.546 | WP_132378463 |
sugar-binding transcriptional regulator [Lachnospiraceae bacterium 5_1_57FAA] hypothetical protein HMPREF0993_00501 [Lachnospiraceae bacterium 5_1_57FAA] |
9.5e-103 | 99 | 53.242 | WP_009248124 |
winged helix-turn-helix transcriptional regulator [[Clostridium] scindens] putative sugar-binding domain protein [[Clostridium] scindens ATCC 35704] Sorbitol operon regulator [[Clostridium] scindens ATCC 35704] |
6.34e-102 | 99 | 52.901 | WP_004607043 |
winged helix-turn-helix transcriptional regulator [[Clostridium] scindens] winged helix-turn-helix transcriptional regulator [[Clostridium] scindens] |
1.93e-101 | 99 | 52.560 | WP_154322384 |
winged helix-turn-helix transcriptional regulator [Lachnospiraceae bacterium KGMB03038] sugar-binding transcriptional regulator [Lachnospiraceae bacterium KGMB03038] |
5.12e-99 | 99 | 51.370 | WP_143931055 |
MULTISPECIES: winged helix-turn-helix transcriptional regulator [Clostridiales] transcriptional regulatory protein [Clostridium sp. D5] |
1.57e-82 | 99 | 43.686 | WP_009002005 |
transcriptional regulator [Lachnoclostridium phytofermentans] |
1.96e-81 | 99 | 44.521 | HCL02368 |
transcriptional regulator [Kineothrix alysoides] DNA-binding transcriptional regulator LsrR (DeoR family) [Kineothrix alysoides] |
1.54e-80 | 99 | 44.330 | WP_031391988 |
sugar-binding transcriptional regulator [Firmicutes bacterium] |
1.24e-72 | 99 | 42.612 | MTI65586 |
transcriptional regulator [Clostridiales bacterium] |
4.12e-72 | 99 | 42.466 | HCI22137 |
sugar-binding transcriptional regulator [Natronincola ferrireducens] DNA-binding transcriptional regulator LsrR, DeoR family [Natronincola ferrireducens] |
6.49e-71 | 99 | 42.617 | WP_090555102 |
MULTISPECIES: winged helix-turn-helix transcriptional regulator [Bacteria] |
5.41e-67 | 99 | 40.614 | WP_081928188 |
hypothetical protein APF77_03520 [Clostridia bacterium BRH_c25] |
7.91e-66 | 99 | 40.550 | KUO73349 |
sugar-binding transcriptional regulator [Alkaliphilus peptidifermentans] DNA-binding transcriptional regulator LsrR, DeoR family [Alkaliphilus peptidifermentans DSM 18978] |
6.62e-64 | 99 | 42.268 | WP_091540129 |
transcriptional regulator [Intestinibacillus sp. Marseille-P4005] |
1.41e-63 | 99 | 39.116 | WP_107631217 |
hypothetical protein DP68_14095 [Clostridium sp. HMP27] |
1.5e-55 | 99 | 38.567 | KGK86334 |
sugar-binding transcriptional regulator [Clostridium peptidivorans] |
2.6e-55 | 99 | 38.908 | WP_097028172 |
sugar-binding transcriptional regulator [Thermanaeromonas toyohensis] DNA-binding transcriptional regulator LsrR, DeoR family [Thermanaeromonas toyohensis ToBE] |
7.22e-51 | 99 | 35.374 | WP_084664714 |
sugar-binding transcriptional regulator [Aneurinibacillus terranovensis] |
7.6e-49 | 99 | 35.374 | WP_027415364 |
hypothetical protein [Actinobacteria bacterium] |
9.25e-49 | 99 | 36.486 | HAX17147 |
sugar-binding transcriptional regulator [Varibaculum timonense] |
1.54e-48 | 99 | 35.739 | WP_080913333 |
DNA-binding transcriptional regulator LsrR (DeoR family) [Alkalibaculum bacchi] |
2.54e-48 | 99 | 35.430 | RBP65380 |
sugar-binding transcriptional regulator [Arthrobacter sp. AFG20] DNA-binding transcriptional regulator [Arthrobacter sp. AFG20] |
3.91e-48 | 99 | 34.007 | WP_102974508 |
sugar-binding transcriptional regulator [Alkalibaculum bacchi] |
4.01e-48 | 99 | 35.430 | WP_113920496 |
sugar-binding transcriptional regulator [Anaerosalibacter bizertensis] sugar-binding transcriptional regulator [Anaerosalibacter bizertensis] |
5.76e-48 | 99 | 36.271 | WP_154482066 |
winged helix-turn-helix transcriptional regulator [Alkalibaculum bacchi] |
6.99e-48 | 99 | 35.430 | WP_148581879 |
sugar-binding transcriptional regulator [Bacillus gottheilii] |
1.14e-47 | 99 | 31.973 | WP_066442932 |
hypothetical protein [Eubacteriaceae bacterium] |
2.35e-47 | 98 | 34.828 | HCX64335 |
winged helix-turn-helix transcriptional regulator [Bacillus mesophilum] sugar-binding transcriptional regulator [Bacillus mesophilum] |
2.78e-47 | 99 | 31.399 | WP_151576090 |
DNA-binding transcriptional regulator [Anaerolineaceae bacterium] |
4.51e-47 | 99 | 35.117 | HAF61848 |
DNA-binding transcriptional regulator [Rhodothermus marinus] DNA-binding transcriptional regulator [Rhodothermus marinus] |
8.16e-47 | 99 | 32.333 | BBM68869 |
sugar-binding transcriptional regulator [Rhodothermus marinus] transcriptional regulator, DeoR family [Rhodothermus marinus SG0.5JP17-172] |
9.18e-47 | 99 | 32.333 | WP_014067692 |
sugar-binding transcriptional regulator [Rhodothermus marinus] transcriptional regulator, DeoR family [Rhodothermus marinus DSM 4252] |
1.19e-46 | 99 | 32.667 | WP_012843196 |
sugar-binding transcriptional regulator [Arthrobacter sp. SPG23] hypothetical protein TV39_09430 [Arthrobacter sp. SPG23] |
3.96e-46 | 99 | 32.660 | WP_043480937 |
helix-turn-helix domain-containing protein [Anaerostipes sp. 494a] hypothetical protein BHF70_08930 [Anaerostipes sp. 494a] |
4.81e-46 | 99 | 33.663 | WP_075760576 |
sugar-binding transcriptional regulator [Anoxybacillus sp. P3H1B] |
5.03e-46 | 99 | 34.932 | WP_066149469 |
sugar-binding transcriptional regulator [Enterococcus florum] DeoR family transcriptional regulator [Enterococcus florum] |
5.03e-46 | 99 | 35.135 | WP_146622819 |
hypothetical protein [Spirochaeta sp.] |
5.43e-46 | 98 | 33.333 | HAK47492 |
Deoxyribonucleoside regulator [Anoxybacillus sp. P3H1B] |
6.2e-46 | 99 | 34.932 | KXG09126 |
MarR family transcriptional regulator [Arthrobacter sp. Soil764] hypothetical protein ASG86_17670 [Arthrobacter sp. Soil764] |
7.04e-46 | 99 | 33.893 | WP_056331452 |
MarR family transcriptional regulator [Pseudarthrobacter equi] DNA-binding transcriptional regulator LsrR, DeoR family [Pseudarthrobacter equi] |
8.62e-46 | 99 | 34.228 | WP_091717175 |
sugar-binding transcriptional regulator [Sporanaerobacter sp. JN28] sugar-binding transcriptional regulator [Sporanaerobacter sp. JN28] |
8.84e-46 | 99 | 33.887 | WP_128753080 |
sugar-binding transcriptional regulator [Sporanaerobacter sp. PP17-6a] |
1.07e-45 | 99 | 33.887 | WP_143037676 |
Deoxyribonucleoside regulator [Sporanaerobacter sp. PP17-6a] |
1.11e-45 | 99 | 33.887 | SCL89734 |
sugar-binding transcriptional regulator [Oceanobacillus limi] DNA-binding transcriptional regulator LsrR, DeoR family [Oceanobacillus limi] |
1.28e-45 | 99 | 34.333 | WP_090867543 |
sugar-binding transcriptional regulator [Megamonas hypermegale] Sor operon activator [Megamonas hypermegale] |
1.29e-45 | 99 | 33.670 | WP_027889779 |
MarR family transcriptional regulator [Pseudarthrobacter sp. NamB4] MarR family transcriptional regulator [Pseudarthrobacter sp. NamB4] |
1.31e-45 | 99 | 33.221 | WP_138135340 |
Deoxyribonucleoside regulator [uncultured Ruminococcus sp.] |
1.74e-45 | 98 | 34.021 | SCH93003 |
sugar-binding transcriptional regulator [Arthrobacter sp. Leaf337] hypothetical protein ASF98_23415 [Arthrobacter sp. Leaf337] |
1.8e-45 | 99 | 31.987 | WP_055803075 |
MULTISPECIES: sugar-binding transcriptional regulator [unclassified Anoxybacillus] transcriptional regulator [Anoxybacillus sp. UARK-01] ArsR family transcriptional regulator [Anoxybacillus sp. PDR2] |
1.84e-45 | 99 | 34.589 | WP_044741685 |
MULTISPECIES: sugar-binding transcriptional regulator [unclassified Dorea] sugar-binding transcriptional regulator [Dorea sp. AM58-8] sugar-binding transcriptional regulator [Dorea sp. AF36-15AT] |
2.21e-45 | 98 | 34.021 | WP_118382673 |
bacterial regulatory, arsR family protein [Anoxybacillus sp. B2M1] bacterial regulatory, arsR family protein [Anoxybacillus sp. B7M1] |
2.31e-45 | 99 | 34.589 | ANB57592 |
Deoxyribonucleoside regulator [uncultured Eubacterium sp.] |
2.88e-45 | 98 | 34.021 | SCH55658 |
sugar-binding transcriptional regulator [Paucisalibacillus sp. EB02] |
3.55e-45 | 100 | 32.203 | WP_042146736 |
transcriptional regulator, DeoR family [Sebaldella termitidis ATCC 33386] Sor operon activator [Sebaldella termitidis] |
4.57e-45 | 99 | 33.445 | ACZ07937 |
sugar-binding transcriptional regulator [Sebaldella termitidis] |
4.8e-45 | 99 | 33.445 | WP_115388831 |
sugar-binding transcriptional regulator [Megamonas hypermegale] Cro/Cl family transcriptional regulator [Megamonas hypermegale] |
1.06e-44 | 99 | 34.007 | WP_087386135 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus] |
1.27e-44 | 99 | 31.525 | WP_061407733 |
hypothetical protein [Alkalibaculum sp. M08DMB] hypothetical protein [Alkalibaculum sp. M08DMB] |
1.38e-44 | 99 | 33.223 | WP_152806860 |
sugar-binding transcriptional regulator [Firmicutes bacterium] |
1.48e-44 | 99 | 33.887 | WP_114218379 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus] |
1.69e-44 | 99 | 31.525 | WP_113767635 |
winged helix-turn-helix transcriptional regulator [Bacillus pumilus] |
1.76e-44 | 99 | 31.525 | WP_144533309 |
sugar-binding transcriptional regulator [Thermoanaerobacter uzonensis] DNA-binding transcriptional regulator LsrR, DeoR family [Thermoanaerobacter uzonensis DSM 18761] |
1.79e-44 | 99 | 34.237 | WP_072968896 |
MULTISPECIES: sugar-binding transcriptional regulator [Bacillus] transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus] hypothetical protein B4127_1820 [Bacillus pumilus] transcriptional regulator [Bacillus sp. 7788] sugar-binding transcriptional regulator [Bacillus sp. NMCC46] |
1.98e-44 | 99 | 31.525 | WP_034662535 |
sugar-binding transcriptional regulator [Bacillus stratosphericus] sugar-binding transcriptional regulator [Bacillus stratosphericus] |
1.98e-44 | 99 | 31.525 | WP_135031834 |
MarR family transcriptional regulator [Arthrobacter sp. ZGTC412] |
2.05e-44 | 99 | 32.886 | WP_104043476 |
sugar-binding transcriptional regulator [Halanaerobium saccharolyticum] hypothetical protein HSACCH_00889 [Halanaerobium saccharolyticum subsp. saccharolyticum DSM 6643] |
2.14e-44 | 99 | 32.082 | WP_005488159 |
sugar-binding transcriptional regulator [Enterococcus pallens] hypothetical protein UAU_03665 [Enterococcus pallens ATCC BAA-351] hypothetical protein I588_03979 [Enterococcus pallens ATCC BAA-351] hypothetical protein RV10_GL001057 [Enterococcus pallens] |
2.21e-44 | 99 | 35.354 | WP_010758639 |
sugar-binding transcriptional regulator [Propionispira arboris] DNA-binding transcriptional regulator LsrR, DeoR family [Propionispira arboris] |
2.23e-44 | 99 | 33.110 | WP_091833081 |
sugar-binding transcriptional regulator [Bacillus safensis] transcriptional regulator [Bacillus safensis] |
2.28e-44 | 99 | 31.525 | WP_087978178 |
sugar-binding transcriptional regulator [Salibacterium qingdaonense] DNA-binding transcriptional regulator LsrR, DeoR family [Salibacterium qingdaonense] |
2.47e-44 | 99 | 32.095 | WP_090925425 |
sugar-binding transcriptional regulator [Bacillus safensis] |
2.51e-44 | 99 | 31.525 | WP_024426934 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus] |
2.64e-44 | 99 | 31.525 | WP_065097234 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus SAFR-032] sugar-binding transcriptional regulator [Bacillus pumilus] |
2.76e-44 | 99 | 31.525 | WP_012009879 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus] |
2.76e-44 | 99 | 31.525 | WP_088001546 |
sugar-binding transcriptional regulator [Bacillus safensis] transcriptional regulator [Bacillus safensis] hypothetical protein B4107_1414 [Bacillus safensis] |
3.17e-44 | 99 | 31.525 | WP_041108914 |
MULTISPECIES: sugar-binding transcriptional regulator [Bacillus] hypothetical protein B4129_1415 [Bacillus safensis] Sorbitol operon regulator [Bacillus pumilus] |
3.24e-44 | 99 | 31.525 | WP_041084926 |
transcriptional regulator [Eubacteriaceae bacterium] |
3.39e-44 | 98 | 32.069 | HAE60881 |
MULTISPECIES: sugar-binding transcriptional regulator [Bacillus] transcriptional regulator [Bacillus safensis FO-36b] transcriptional regulator [Bacillus safensis] sugar-binding transcriptional regulator [Bacillus safensis] transcriptional regulator [Bacillus safensis FO-36b] transcriptional regulator [Bacillus safensis] |
3.42e-44 | 99 | 31.525 | WP_024424249 |
MULTISPECIES: sugar-binding transcriptional regulator [Aeribacillus] transcriptional regulator [Aeribacillus pallidus] |
3.49e-44 | 99 | 33.904 | WP_094246427 |
winged helix-turn-helix transcriptional regulator [Bacillus pumilus] |
3.64e-44 | 99 | 31.525 | WP_144483727 |
sugar-binding transcriptional regulator [Arthrobacter sp. 35/47] |
3.98e-44 | 99 | 32.323 | WP_026545215 |
MarR family transcriptional regulator [Arthrobacter sp. PGP41] DNA-binding transcriptional regulator [Arthrobacter sp. PGP41] |
4.05e-44 | 99 | 32.550 | WP_104997636 |
DNA-binding transcriptional regulator LsrR (DeoR family) [Aeribacillus composti] |
4.14e-44 | 99 | 33.904 | TVZ85781 |
sugar-binding transcriptional regulator [Aeribacillus pallidus] sugar-binding transcriptional regulator [Aeribacillus pallidus] |
4.32e-44 | 99 | 33.904 | WP_130158529 |
winged helix-turn-helix transcriptional regulator [Bacillus megaterium] Deoxyribonucleoside regulator [Bacillus megaterium] |
4.41e-44 | 99 | 31.058 | WP_155660860 |
sugar-binding transcriptional regulator [Anaerofustis stercorihominis] putative sugar-binding domain protein [Anaerofustis stercorihominis DSM 17244] sugar-binding transcriptional regulator [Anaerofustis stercorihominis] |
4.59e-44 | 99 | 30.508 | WP_007048864 |
MULTISPECIES: sugar-binding transcriptional regulator [Bacillus] transcriptional regulator [Bacillus sp. P003] transcriptional regulator [Bacillus sp. I-2] transcriptional regulator [Bacillus safensis] transcriptional regulator [Bacillus safensis] transcriptional regulator [Bacillus safensis] |
4.71e-44 | 99 | 31.525 | WP_061109809 |
transcriptional regulator [Bacillaceae bacterium ZC4] |
5.01e-44 | 99 | 33.904 | AXI40446 |
MULTISPECIES: sugar-binding transcriptional regulator [Bacillus] transcriptional regulator [Bacillus sp. Root920] Sorbitol operon regulator [Bacillus safensis] |
5.24e-44 | 99 | 31.186 | WP_056766375 |
sugar-binding transcriptional regulator [Bacillus stratosphericus] transcriptional regulator [Bacillus stratosphericus] |
5.41e-44 | 99 | 31.525 | WP_103132569 |
sugar-binding transcriptional regulator [Bacillus australimaris] transcriptional regulator [Bacillus australimaris] |
5.95e-44 | 99 | 31.633 | WP_060699150 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus] |
6.21e-44 | 99 | 31.186 | WP_106033188 |
sugar-binding transcriptional regulator [Bacillus subterraneus] transcriptional regulator [Bacillus subterraneus] |
6.69e-44 | 99 | 33.333 | WP_044393543 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus] sugar-binding transcriptional regulator [Bacillus pumilus] sugar-binding transcriptional regulator [Bacillus pumilus] sugar-binding transcriptional regulator [Bacillus pumilus] sugar-binding transcriptional regulator [Bacillus pumilus] |
7.37e-44 | 99 | 31.186 | WP_050945093 |
sugar-binding transcriptional regulator [Bacillus pumilus] transcriptional regulator [Bacillus pumilus ATCC 7061] transcriptional regulator [Bacillus pumilus] |
7.53e-44 | 99 | 31.525 | WP_003211684 |
sugar-binding transcriptional regulator [Aeribacillus pallidus] transcriptional regulator [Aeribacillus pallidus] |
8.74e-44 | 99 | 33.904 | WP_063386370 |
sugar-binding transcriptional regulator [Aeribacillus pallidus] transcriptional regulator [Aeribacillus pallidus] sugar-binding transcriptional regulator [Bacillaceae bacterium] |
8.93e-44 | 99 | 33.904 | WP_066247035 |
sugar-binding transcriptional regulator [Bacillus safensis] |
9.02e-44 | 99 | 31.186 | WP_064498415 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_28 In ecoli U00096.3
Seq (len = 64 ):
MKRCLPLTHSPACSGCFLITASPLPLKIFRTIRPLTSHCGWIIKTARSLHYSFSTGGLRAGPNG
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|167803|1|4608649-4608868
Transkriptom
82.0% of gene length expressed over median expression of contig.
ŝ
2.3861581781239303
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
5'-nucleotidase (nucleoside 5'-monophosphate phosphohydrolase) [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
5'-nucleotidase (nucleoside 5'-monophosphate phosphohydrolase) [Escherichia coli] |
4.25e-22 | 75 | 89.583 | STJ62366 |
pyrimidine 5'-nucleotidase [Escherichia coli] |
1.01e-11 | 45 | 100.000 | WP_077880222 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_29 In blautia CP039126.1
Seq (len = 38 ):
ITAGPDLVAVQGVVTAGGDKDKCNQIVGLTNLFGSVYA
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|326469|-1|3549853-3549997
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.4784260964080063
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_30 In clostri CP040627.1
Seq (len = 268 ):
MYKTHKAVNNISFVVKKGEILGFLGPNGAGKSTTINVLSTVLKPDDGKINFLGENINNNIFNVKKNIGVVPQDLAIYEDIPAERNVRFFASLYGLKGKDLDTKVKEALEFVKLYDRKDEKPKSFSGGMKRRLNIACAIAHDPKLIIMDEPTVGIDPQSRNHILESILKLKEKGATIIYTTHYMEEVEEIADRIIIIDNGSIVAEGSKEELKESIKDERIYNIYADNIENLSGNIFFKIEGVKKVDIQKNCICITTLNTIENLDKIILF
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040627.1|13564|1|187168-188011
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
5.552841968657781
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
ABC transporter ATPase [Clostridium butyricum]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
ABC transporter ATPase [Clostridium butyricum] ABC transporter ATPase [Clostridium butyricum] |
0.0 | 100 | 100.000 | BBK79037 |
ABC transporter ATP-binding protein [Clostridium butyricum] ABC transporter ATP-binding protein [Clostridium butyricum] |
0.0 | 100 | 99.627 | WP_124230025 |
ABC transporter ATP-binding protein [Clostridium butyricum] antibiotic ABC transporter ATP-binding protein [Clostridium butyricum] antibiotic ABC transporter ATP-binding protein [Clostridium butyricum] |
0.0 | 100 | 99.627 | WP_043665171 |
ABC transporter ATP-binding protein [Clostridium butyricum] antibiotic ABC transporter ATP-binding protein [Clostridium butyricum] antibiotic ABC transporter ATP-binding protein [Clostridium butyricum] antibiotic ABC transporter ATP-binding protein [Clostridium butyricum] antibiotic ABC transporter ATP-binding protein [Clostridium butyricum] ABC transporter ATP-binding protein [Clostridium butyricum] |
0.0 | 100 | 99.254 | WP_058372012 |
ABC transporter ATP-binding protein [Clostridium butyricum] |
0.0 | 100 | 99.254 | WP_027634762 |
ABC transporter ATP-binding protein [Clostridium butyricum] ABC-type MDR transport system, ATPase component [Clostridium butyricum DKU-01] |
0.0 | 100 | 98.507 | WP_003431569 |
ATP-binding cassette domain-containing protein [Clostridium perfringens] |
0.0 | 100 | 98.507 | WP_154826223 |
MULTISPECIES: ABC transporter ATP-binding protein [Clostridium] ABC-type MDR transporter, ATPase component [Clostridium sp. IBUN125C] hypothetical protein ClosIBUN13A_CONTIG252g04081 [Clostridium sp. IBUN13A] ABC-type MDR transporter, ATPase component [Clostridium sp. IBUN22A] |
0.0 | 100 | 98.134 | WP_045143709 |
ATP-binding cassette domain-containing protein [Clostridium butyricum] ABC transporter ATP-binding protein [Clostridium butyricum] ABC transporter ATP-binding protein [Clostridium butyricum] |
0.0 | 100 | 97.761 | WP_153738866 |
ABC transporter ATP-binding protein [Clostridium butyricum] |
0.0 | 100 | 97.761 | WP_033127810 |
ATP-binding cassette domain-containing protein [Clostridium butyricum] |
0.0 | 100 | 97.761 | WP_148347301 |
ABC transporter ATP-binding protein [Clostridium acetobutylicum] antibiotic ABC transporter ATP-binding protein [Clostridium acetobutylicum] |
1.4e-139 | 99 | 74.436 | WP_034584802 |
MULTISPECIES: ABC transporter ATP-binding protein [Clostridium] MDR ABC transporter ATPase [Clostridium acetobutylicum ATCC 824] ABC-type MDR transport system, ATPase component [Clostridium acetobutylicum EA 2018] ABC-type MDR transport system, ATPase component [Clostridium acetobutylicum DSM 1731] ABC-type MDR transport system, ATPase component [Clostridium acetobutylicum ATCC 824] ABC transporter ATP-binding protein [Clostridium acetobutylicum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium acetobutylicum] |
2.36e-139 | 99 | 74.436 | WP_010966871 |
antibiotic ABC transporter ATP-binding protein [Clostridium butyricum] |
2.68e-138 | 74 | 98.995 | KQB78812 |
MULTISPECIES: ABC transporter ATP-binding protein [Clostridium] ABC transporter ATP-binding protein [Clostridium sp. CT7] |
2.8e-138 | 99 | 74.060 | WP_066021359 |
ABC transporter ATP-binding protein [Clostridium felsineum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium felsineum DSM 794] |
7.35e-138 | 99 | 73.308 | WP_077895331 |
ABC transporter ATP-binding protein [Clostridium aurantibutyricum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium aurantibutyricum] |
4.57e-137 | 99 | 72.932 | WP_077852925 |
ABC transporter ATP-binding protein [Clostridium roseum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium roseum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium roseum] |
5.1e-137 | 99 | 72.932 | WP_077834648 |
ABC transporter ATP-binding protein [Clostridium botulinum] export ABC transporter ATP-binding protein [Clostridium botulinum] |
1.67e-134 | 99 | 72.180 | WP_106574493 |
MULTISPECIES: ABC transporter ATP-binding protein [Clostridium] ABC transporter family protein [Clostridium botulinum] |
1.57e-133 | 99 | 71.805 | WP_045886662 |
ABC transporter ATP-binding protein [Clostridium botulinum] export ABC transporter ATP-binding protein [Clostridium botulinum] export ABC transporter ATP-binding protein [Clostridium botulinum] |
2.75e-133 | 99 | 71.805 | WP_106899691 |
MULTISPECIES: ABC transporter ATP-binding protein [Clostridium] ABC transporter family protein [Clostridium botulinum Prevot_594] ABC-type multidrug transport system, ATPase component [Clostridium sporogenes] antibiotic ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium botulinum] ABC transporter ATP-binding protein [Clostridium botulinum] |
1.02e-132 | 99 | 71.805 | WP_033059235 |
ABC transporter ATP-binding protein [Clostridium sporogenes] |
1.6e-132 | 99 | 71.805 | WP_045904185 |
ABC transporter ATP-binding protein [Clostridium botulinum] ABC-type MDR transport system, ATPase component [Clostridium botulinum Ba4 str. 657] ABC transporter family protein [Clostridium botulinum CDC_297] ABC transporter family protein [Clostridium botulinum CDC_1436] Nod factor export ATP-binding protein I [Clostridium botulinum Bf] ABC transporter family protein [Clostridium botulinum] |
1.74e-132 | 99 | 71.805 | WP_003360783 |
ABC transporter ATP-binding protein [Clostridium botulinum] export ABC transporter ATP-binding protein [Clostridium botulinum] |
2.12e-132 | 99 | 71.805 | WP_061316745 |
ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] |
2.87e-132 | 99 | 71.805 | WP_058012638 |
ABC transporter ATP-binding protein [Clostridium botulinum] ABC transporter ATP-binding protein [Clostridium botulinum] |
3.84e-132 | 99 | 71.805 | WP_134864987 |
ABC transporter ATP-binding protein [Clostridium botulinum] ABC transporter, ATP-binding protein [Clostridium botulinum F str. Langeland] ABC transporter, ATP-binding protein [Clostridium botulinum F str. 230613] antibiotic ABC transporter ATP-binding protein [Clostridium botulinum] |
4.01e-132 | 99 | 71.805 | WP_012099651 |
ABC transporter ATP-binding protein [Clostridium sporogenes] antibiotic ABC transporter ATP-binding protein [Clostridium sporogenes] antibiotic ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium botulinum] |
5.21e-132 | 99 | 71.429 | WP_045519713 |
ABC transporter ATP-binding protein [Clostridium botulinum] ABC transporter family protein [Clostridium botulinum] |
8.07e-132 | 99 | 71.053 | WP_072584443 |
ABC transporter ATP-binding protein [Clostridium botulinum] ABC transporter, ATP-binding protein [Clostridium botulinum B1 str. Okra] |
8.81e-132 | 99 | 71.805 | WP_015957984 |
ABC transporter ATP-binding protein [Clostridium botulinum] antibiotic ABC transporter ATP-binding protein [Clostridium botulinum] antibiotic ABC transporter ATP-binding protein [Clostridium botulinum] |
1.38e-131 | 99 | 71.805 | WP_053338100 |
MULTISPECIES: ABC transporter ATP-binding protein [Clostridium] ABC transporter, ATP-binding protein [Clostridium sporogenes ATCC 15579] antibiotic ABC transporter ATP-binding protein [Clostridium botulinum B2 450] export ABC transporter ATP-binding protein [Clostridium sporogenes] MDR ABC transporter ATPase [Clostridium botulinum B str. Osaka05] |
3.5e-131 | 96 | 73.152 | WP_003486378 |
ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] ABC transporter ATP-binding protein [Clostridium sporogenes] |
4.03e-131 | 99 | 71.053 | WP_058008476 |
ABC transporter ATP-binding protein [Clostridium sporogenes] ABC-type MDR transport system, ATPase [Clostridium sporogenes PA 3679] |
8.39e-131 | 99 | 71.053 | WP_003491187 |
ABC transporter ATP-binding protein [Clostridium botulinum] ABC transporter ATP-binding protein [Clostridium botulinum] |
1.42e-130 | 99 | 71.429 | WP_129265736 |
ABC transporter ATP-binding protein [Clostridium tetanomorphum] ABC transporter ATP-binding protein [Clostridium tetanomorphum DSM 665] ABC transporter ATP-binding protein [Clostridium tetanomorphum DSM 665] |
3.56e-128 | 99 | 69.925 | WP_035148130 |
ABC transporter ATP-binding protein [Gottschalkia purinilytica] Nod factor export ATP-binding protein I [Gottschalkia purinilytica] |
3.36e-120 | 99 | 66.292 | WP_050355407 |
ABC transporter ATP-binding protein [Clostridium argentinense] export ABC transporter ATP-binding protein [Clostridium argentinense] ABC transporter family protein [Clostridium argentinense CDC 2741] |
1.79e-119 | 99 | 66.165 | WP_039635351 |
ABC transporter ATP-binding protein [Clostridium beijerinckii] antibiotic ABC transporter ATP-binding protein [Clostridium beijerinckii] |
2.6e-119 | 99 | 65.283 | WP_065417794 |
MULTISPECIES: ABC transporter ATP-binding protein [Paenibacillaceae] ABC transporter ATP-binding protein [Chlamydia abortus] |
8.93e-119 | 99 | 63.396 | WP_144932649 |
ATP-binding cassette domain-containing protein [Clostridium estertheticum] ABC transporter ATP-binding protein [Clostridium estertheticum] ABC transporter ATP-binding protein [Clostridium estertheticum] |
1.88e-118 | 99 | 64.528 | WP_152752823 |
ABC transporter ATP-binding protein [Clostridium arbusti] |
5.48e-118 | 99 | 64.528 | WP_010235122 |
ABC transporter ATP-binding protein [Clostridium estertheticum] antibiotic ABC transporter ATP-binding protein [Clostridium estertheticum subsp. estertheticum] ABC transporter ATP-binding protein [Clostridium estertheticum subsp. laramiense] |
6.39e-118 | 99 | 64.151 | WP_071613531 |
ABC transporter ATP-binding protein [Clostridium acidisoli] ABC-2 type transport system ATP-binding protein [Clostridium acidisoli DSM 12555] |
1.47e-117 | 99 | 67.925 | WP_084115161 |
ABC transporter ATP-binding protein [Clostridium sp. LS] ABC-type multidrug transport system, ATPase component [Clostridium sp. Maddingley MBC34-26] |
1.52e-117 | 99 | 64.419 | WP_008421086 |
MULTISPECIES: ABC transporter ATP-binding protein [unclassified Bacillus] ABC-2 type transport system ATP-binding protein [Bacillus sp. 71mf] ABC-2 type transport system ATP-binding protein [Bacillus sp. 103mf] |
3.75e-117 | 99 | 64.528 | WP_090915561 |
ATP-binding cassette domain-containing protein [Clostridium akagii] |
8.73e-117 | 99 | 65.660 | WP_156946286 |
ABC transporter ATP-binding protein [Bacillus pseudomycoides] export ABC transporter ATP-binding protein [Bacillus pseudomycoides] |
2.77e-116 | 99 | 65.660 | WP_098915298 |
ABC transporter ATP-binding protein [Clostridium beijerinckii] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium beijerinckii] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium beijerinckii] putative ABC transporter (ATP-binding protein) [Clostridium beijerinckii] |
2.77e-116 | 99 | 66.415 | WP_077843120 |
ABC transporter ATP-binding protein [Clostridium beijerinckii] |
8.55e-116 | 99 | 66.415 | WP_026887338 |
MULTISPECIES: ABC transporter ATP-binding protein [Clostridium] ABC transporter ATP-binding protein [Clostridium sp. CT7] |
1.28e-115 | 99 | 64.286 | WP_066020376 |
ABC transporter ATP-binding protein [Paenibacillus larvae] spermidine/putrescine import ATP-binding protein potA [Paenibacillus larvae subsp. larvae DSM 25430] export ABC transporter ATP-binding protein [Paenibacillus larvae subsp. larvae] spermidine/putrescine import ATP-binding protein potA [Paenibacillus larvae subsp. larvae DSM 25719] ABC transporter-like protein [Paenibacillus larvae subsp. larvae B-3650] spermidine/putrescine import ATP-binding protein potA [Paenibacillus larvae subsp. larvae] |
2.5e-115 | 99 | 62.264 | WP_023485165 |
ABC transporter ATP-binding protein [Bacillus sp. 123MFChir2] |
3.1e-115 | 99 | 64.151 | WP_020059620 |
ABC transporter ATP-binding protein [Clostridium cavendishii] ABC-2 type transport system ATP-binding protein [Clostridium cavendishii DSM 21758] |
3.18e-115 | 99 | 63.060 | WP_072986106 |
ABC transporter ATP-binding protein [Clostridium saccharoperbutylacetonicum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium saccharoperbutylacetonicum] |
3.43e-115 | 99 | 62.687 | WP_077365874 |
ABC transporter ATP-binding protein [Numidum massiliense] |
3.63e-115 | 99 | 61.049 | WP_054949295 |
ABC transporter ATP-binding protein [Numidum massiliense] |
7.08e-115 | 99 | 60.902 | WP_054949320 |
ABC transporter ATP-binding protein [Clostridium tetanomorphum] |
9.35e-115 | 88 | 70.339 | SQB92048 |
ABC transporter ATP-binding protein [Paenibacillus larvae] export ABC transporter ATP-binding protein [Paenibacillus larvae subsp. pulvifaciens] export ABC transporter ATP-binding protein [Paenibacillus larvae subsp. pulvifaciens] spermidine/putrescine import ATP-binding protein potA [Paenibacillus larvae subsp. larvae] spermidine/putrescine import ATP-binding protein potA [Paenibacillus larvae subsp. larvae] |
2.4e-114 | 99 | 61.887 | WP_077996103 |
ABC transporter ATP-binding protein [Paenibacillus polymyxa] spermidine/putrescine import ATP-binding protein potA [Paenibacillus polymyxa M1] |
3.6e-114 | 99 | 62.030 | WP_014600087 |
ABC transporter ATP-binding protein [Paenibacillus sp. 1-18] |
4.43e-114 | 99 | 61.654 | WP_025718060 |
ABC transporter ATP-binding protein [Clostridium chromiireducens] ABC transporter ATP-binding protein [Clostridium chromiireducens] |
4.45e-114 | 99 | 61.905 | WP_119366693 |
ABC transporter ATP-binding protein [Clostridium saccharoperbutylacetonicum] ABC-type multidrug transport system, ATPase component [Clostridium saccharoperbutylacetonicum N1-4(HMT)] |
1.02e-113 | 99 | 61.567 | WP_015394780 |
ATP-binding cassette domain-containing protein [Paenibacillus brasilensis] |
1.24e-113 | 99 | 61.278 | WP_152381669 |
ABC transporter ATP-binding protein [Bacillus nakamurai] antibiotic ABC transporter ATP-binding protein [Bacillus nakamurai] |
3.12e-113 | 99 | 62.030 | WP_061521371 |
ABC transporter ATP-binding protein [Paenibacillus tianmuensis] ABC-2 type transport system ATP-binding protein [Paenibacillus tianmuensis] |
3.49e-113 | 99 | 63.019 | WP_090670167 |
ATP-binding cassette domain-containing protein [Clostridium chromiireducens] |
4.32e-113 | 99 | 61.538 | MVX63291 |
ABC transporter ATP-binding protein [Clostridium chromiireducens] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium chromiireducens] |
4.66e-113 | 99 | 61.538 | WP_079439232 |
ABC transporter ATP-binding protein [Acetobacterium woodii] ABC transport system ATP-binding protein [Acetobacterium woodii DSM 1030] |
7.66e-113 | 97 | 64.865 | WP_014357519 |
ATP-binding cassette domain-containing protein [Acetobacterium paludosum] |
1.11e-112 | 99 | 63.019 | WP_148565371 |
ABC transporter ATP-binding protein [Bacillus sp. 123MFChir2] |
2.05e-112 | 99 | 61.509 | WP_020062466 |
ABC transporter ATP-binding protein [Clostridium saccharobutylicum] ABC transporter ATP-binding protein YfiL [Clostridium saccharobutylicum DSM 13864] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium saccharobutylicum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium saccharobutylicum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium saccharobutylicum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium saccharobutylicum] |
2.31e-112 | 99 | 63.060 | WP_022746665 |
ABC transporter ATP-binding protein [Paenibacillus apiarius] |
3.57e-112 | 100 | 57.463 | WP_087432268 |
ABC transporter ATP-binding protein [Acetobacterium sp. KB-1] export ABC transporter ATP-binding protein [Acetobacterium sp. KB-1] |
6.04e-112 | 99 | 61.887 | WP_111889087 |
ABC transporter ATP-binding protein [Paenibacillus sp. OSY-SE] |
6.59e-112 | 100 | 57.463 | WP_019420829 |
ABC transporter ATP-binding protein [Clostridium sp. CT4] export ABC transporter ATP-binding protein [Clostridium sp. CT4] |
1.01e-111 | 99 | 64.151 | WP_128213170 |
ABC transporter ATP-binding protein [Paenibacillus elgii] export ABC transporter ATP-binding protein [Paenibacillus elgii] |
1.26e-111 | 99 | 62.406 | WP_108531476 |
ATP-binding cassette domain-containing protein [Paenibacillus tyrfis] |
1.33e-111 | 99 | 63.158 | WP_152570615 |
ABC transporter ATP-binding protein [Paenibacillus elgii] |
1.44e-111 | 99 | 63.158 | WP_088832022 |
ABC transporter ATP-binding protein [[Clostridium] fimetarium] ABC-2 type transport system ATP-binding protein [[Clostridium] fimetarium] |
2.03e-111 | 97 | 62.835 | WP_092452592 |
ABC transporter ATP-binding protein [Clostridium saccharobutylicum] daunorubicin/doxorubicin resistance ATP-binding protein DrrA [Clostridium saccharobutylicum] |
2.06e-111 | 99 | 62.313 | WP_077867466 |
ABC transporter ATP-binding protein [Bacillus atrophaeus] hypothetical protein B4144_3613 [Bacillus atrophaeus] |
2.14e-111 | 99 | 60.377 | WP_061570749 |
antibiotic ABC transporter ATP-binding protein [Paenibacillus tyrfis] |
2.37e-111 | 99 | 63.158 | KEQ25920 |
ABC transporter ATP-binding protein [Robinsoniella peoriensis] |
2.95e-111 | 99 | 61.887 | WP_044293876 |
ABC transporter ATP-binding protein [Paenibacillus elgii] |
3.88e-111 | 99 | 62.406 | WP_082866834 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacillus] export ABC transporter ATP-binding protein [Bacillus sp. AFS098217] export ABC transporter ATP-binding protein [Bacillus pseudomycoides] export ABC transporter ATP-binding protein [Bacillus sp. AFS019443] export ABC transporter ATP-binding protein [Bacillus sp. AFS014408] export ABC transporter ATP-binding protein [Bacillus sp. AFS075034] |
4e-111 | 99 | 62.264 | WP_097897251 |
unnamed protein product ABC transporter ATP-binding protein [Clostridium beijerinckii NRRL B-598] |
5.43e-111 | 99 | 62.547 | WP_023973199 |
ABC transporter ATP-binding protein [Robinsoniella sp. KNHs210] |
5.86e-111 | 99 | 61.509 | WP_027296233 |
ABC transporter ATP-binding protein [Robinsoniella peoriensis] hypothetical protein RHS_3660 [Robinsoniella sp. RHS] putative ABC transporter ATP-binding protein YbhF [Robinsoniella peoriensis] |
6.68e-111 | 99 | 61.509 | WP_047833871 |
antibiotic ABC transporter ATP-binding protein [Paenibacillus elgii] |
7.37e-111 | 99 | 62.406 | KZE82097 |
ABC transporter ATP-binding protein [Bacillus halotolerans] antibiotic ABC transporter ATP-binding protein [Bacillus halotolerans] |
8.97e-111 | 99 | 61.887 | WP_059293229 |
ABC transporter ATP-binding protein [Bacillus halotolerans] antibiotic ABC transporter ATP-binding protein [[Brevibacterium] halotolerans] [Bacillus halotolerans] |
1.19e-110 | 99 | 61.887 | WP_069487386 |
ABC transporter ATP-binding protein [Bacillus halotolerans] export ABC transporter ATP-binding protein [Bacillus halotolerans] |
1.34e-110 | 99 | 62.642 | WP_101863264 |
ABC transporter ATP-binding protein [Bacillus atrophaeus] ABC-type MDR transporter, ATPase component [Bacillus atrophaeus 1942] ABC transporter family protein [Bacillus atrophaeus subsp. globigii] antibiotic ABC transporter ATP-binding protein [Bacillus subtilis subsp. globigii] ABC-type MDR transporter, ATPase [Bacillus atrophaeus C89] ABC transporter family protein [Bacillus atrophaeus] |
1.47e-110 | 99 | 60.000 | WP_003326827 |
ABC transporter ATP-binding protein [Bacillus atrophaeus] antibiotic ABC transporter ATP-binding protein [Bacillus atrophaeus] ABC transporter ATPase [Bacillus atrophaeus] |
1.73e-110 | 99 | 60.000 | WP_061669218 |
ATP-binding cassette domain-containing protein [Bacillus halotolerans] ABC transporter ATP-binding protein [Bacillus halotolerans] |
2.08e-110 | 99 | 62.264 | WP_151175075 |
ABC transporter ATP-binding protein [Clostridium beijerinckii] antibiotic ABC transporter ATP-binding protein [Clostridium beijerinckii] |
2.13e-110 | 99 | 62.172 | WP_065418817 |
ABC transporter ATP-binding protein [Bacillus atrophaeus] export ABC transporter ATP-binding protein [Bacillus atrophaeus] |
2.29e-110 | 99 | 60.000 | WP_151290168 |
ABC transporter ATP-binding protein [Bacillus halotolerans] antibiotic ABC transporter ATP-binding protein [[Brevibacterium] halotolerans] [Bacillus halotolerans] antibiotic ABC transporter ATP-binding protein [Bacillus halotolerans] export ABC transporter ATP-binding protein [Bacillus halotolerans] |
3.05e-110 | 99 | 61.887 | WP_059336525 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_31 In bifi AE014295.3
Seq (len = 181 ):
LRQTHDDGQGEQQRNRHAHQRREGEGEHGHDLHGERKPAHAGLAETVEGAGVERGDAAHGQHIGGAHGAGDGPIVVEMVERQNDAETHHGNRQSCHRTGQAERLGSGQHEQALIGRVGSGRLRNRASRGHNNSLLVRCPARAPAHTCHPRVAVPQQRHAVRFNRGPVRGQSSSSSEMPCDA
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|22962|1|1055123-1055669
Transkriptom
98.0% of gene length expressed over median expression of contig.
ŝ
2.710708407607263
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
MULTISPECIES: 3-isopropylmalate dehydrogenase [Blautia]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Clostridiales bacterium VE202-06] |
1.53e-45 | 100 | 100.000 | WP_029470741 |
3-isopropylmalate dehydrogenase [Blautia producta] hypothetical protein PMF13cell1_00206 [Blautia producta] |
8.05e-34 | 97 | 86.667 | WP_130179517 |
3-isopropylmalate dehydrogenase [Blautia coccoides] hypothetical protein EV205_1139 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
8.83e-33 | 97 | 85.333 | WP_115624245 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [Blautia] |
1.29e-29 | 92 | 77.465 | WP_095174847 |
hypothetical protein [Blautia producta] |
5.51e-23 | 92 | 66.197 | WP_148391799 |
3-isopropylmalate dehydrogenase [Blautia marasmi] |
7.54e-23 | 92 | 69.014 | WP_104803872 |
3-isopropylmalate dehydrogenase, partial [Blautia producta] |
7.47e-22 | 92 | 66.197 | POP35903 |
hypothetical protein PMF13cell1_00621 [Blautia producta] |
1.2e-21 | 92 | 66.197 | QBE95119 |
hypothetical protein [Blautia producta] |
1.39e-21 | 92 | 66.197 | WP_130179762 |
3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] |
7.19e-21 | 92 | 66.197 | WP_118593835 |
MULTISPECIES: hypothetical protein [Blautia] |
3.49e-19 | 92 | 60.563 | WP_095175458 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [unclassified Blautia] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. AF13-16] |
4.82e-19 | 92 | 59.155 | WP_118594227 |
3-isopropylmalate dehydrogenase [Blautia producta] |
5.02e-19 | 92 | 59.155 | WP_148394072 |
hypothetical protein [Blautia producta] |
5.3e-19 | 84 | 61.538 | WP_033143667 |
3-isopropylmalate dehydrogenase [Blautia coccoides] hypothetical protein EV205_103184 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
1.17e-17 | 92 | 57.333 | WP_115623474 |
hypothetical protein [Clostridiales bacterium VE202-06] |
2.74e-17 | 92 | 55.696 | WP_029467825 |
3-isopropylmalate dehydrogenase [Blautia producta] hypothetical protein PMF13cell1_05544 [Blautia producta] |
4.45e-17 | 92 | 56.000 | WP_130182843 |
3-isopropylmalate dehydrogenase, partial [Blautia producta] |
2.89e-16 | 81 | 62.903 | POP36366 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [unclassified Blautia] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. AF13-16] |
1.27e-15 | 81 | 62.903 | WP_118594065 |
3-isopropylmalate dehydrogenase [Blautia producta] |
1.4e-15 | 81 | 62.903 | WP_148391800 |
3-isopropylmalate dehydrogenase, partial [Blautia producta] 3-isopropylmalate dehydrogenase, partial [Blautia producta] |
2.25e-15 | 82 | 58.730 | WP_103733130 |
3-isopropylmalate dehydrogenase [Blautia producta] hypothetical protein PMF13cell1_00620 [Blautia producta] |
2.71e-15 | 82 | 60.317 | WP_130179761 |
hypothetical protein [Blautia producta] |
1.11e-14 | 81 | 61.290 | WP_033144180 |
hypothetical protein [Hungateiclostridium saccincola] |
1.64e-14 | 82 | 53.968 | WP_133161638 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [Blautia] 3-isopropylmalate dehydrogenase [Blautia producta] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. AF13-16] |
1.77e-14 | 92 | 56.338 | WP_103731296 |
hypothetical protein [Blautia producta] |
1.77e-14 | 92 | 56.338 | WP_033141946 |
hypothetical protein B9R14_09230 [Hungateiclostridium saccincola] |
2.41e-14 | 82 | 53.968 | PQQ66906 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia producta] hypothetical protein PMF13cell1_05058 [Blautia producta] |
4.68e-14 | 95 | 50.685 | WP_130182527 |
hypothetical protein DXA36_32500, partial [Eisenbergiella sp. OF01-20] |
9.14e-14 | 90 | 47.826 | RHP77887 |
putative transposase/invertase (TIGR01784 family) [Blautia coccoides] PD-(D/E)XK nuclease family transposase [Blautia coccoides] |
1.47e-13 | 95 | 49.315 | TCO64055 |
hypothetical protein DXA36_31650, partial [Eisenbergiella sp. OF01-20] |
2.06e-13 | 92 | 45.070 | RHP78853 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia producta] |
2.56e-13 | 95 | 49.315 | WP_018598548 |
conserved hypothetical protein (putative transposase or invertase) [Hespellia stercorisuis DSM 15480] |
2.63e-13 | 82 | 55.556 | SHK51082 |
Rpn family recombination-promoting nuclease/putative transposase, partial [Hespellia stercorisuis] |
2.83e-13 | 82 | 55.556 | WP_143160752 |
hypothetical protein [Hungateiclostridium alkalicellulosi] hypothetical protein Cloal_1441 [Hungateiclostridium alkalicellulosi] |
5.42e-13 | 92 | 52.113 | WP_148891090 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia producta] |
1.51e-12 | 95 | 42.466 | WP_148393401 |
hypothetical protein B5F07_06845, partial [Lachnoclostridium sp. An169] |
1.82e-12 | 82 | 50.794 | OUP84546 |
hypothetical protein D7V81_01225 [bacterium 1XD21-70] |
2.53e-12 | 82 | 49.206 | RKI17894 |
hypothetical protein [bacterium 1XD21-70] |
2.59e-12 | 82 | 49.206 | WP_147434927 |
hypothetical protein B5F18_12340, partial [Lachnoclostridium sp. An181] |
3.75e-12 | 88 | 44.118 | OUP47004 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiaceae] hypothetical protein CLOSTHATH_03954 [[Clostridium] hathewayi DSM 13479] [Hungatella hathewayi DSM 13479] Rpn family recombination-promoting nuclease/putative transposase [Hungatella hathewayi] Rpn family recombination-promoting nuclease/putative transposase [Hungatella hathewayi] |
4.59e-12 | 90 | 44.928 | WP_006774419 |
putative uncharacterized protein [Clostridium hathewayi CAG:224] |
4.82e-12 | 71 | 52.727 | CCZ62539 |
PD-(D/E)XK nuclease family transposase [Hungatella hathewayi] |
5.17e-12 | 71 | 52.727 | CUQ40663 |
Rpn family recombination-promoting nuclease/putative transposase [Hungatella hathewayi] Rpn family recombination-promoting nuclease/putative transposase [Hungatella hathewayi] |
5.24e-12 | 71 | 52.727 | WP_081034954 |
hypothetical protein [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
6.59e-12 | 78 | 48.333 | WP_158348878 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia producta] |
8.49e-12 | 95 | 43.836 | WP_052099177 |
MULTISPECIES: hypothetical protein [unclassified Clostridiales (miscellaneous)] |
1.59e-11 | 83 | 48.438 | WP_025482579 |
hypothetical protein BLA28_11245 [Eisenbergiella tayi] |
1.65e-11 | 92 | 38.028 | OIZ65143 |
hypothetical protein CBFG_04055 [Clostridiales bacterium 1_7_47FAA] |
1.67e-11 | 83 | 48.438 | EEQ60343 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia marasmi] |
1.99e-11 | 95 | 46.154 | WP_104802557 |
hypothetical protein DXB25_30345, partial [Lachnospiraceae bacterium OM02-31] |
2.09e-11 | 88 | 39.706 | RJW37983 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] hypothetical protein C3R19_09010 [Blautia producta] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. OF01-4LB] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. AF13-16] |
2.12e-11 | 95 | 42.466 | WP_103731698 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] hypothetical protein A4V09_02010 [Blautia sp. YL58] hypothetical protein ADH70_000330 [Blautia coccoides] |
2.89e-11 | 95 | 43.836 | WP_065540869 |
hypothetical protein C804_01403 [Lachnospiraceae bacterium A4] |
6.56e-11 | 86 | 43.939 | EOS34754 |
Uncharacterised protein [uncultured Eubacterium sp.] |
6.65e-11 | 78 | 48.333 | SCJ87943 |
hypothetical protein [[Clostridium] glycyrrhizinilyticum] |
7.6e-11 | 75 | 51.724 | WP_157050183 |
hypothetical protein [[Clostridium] glycyrrhizinilyticum] |
8.22e-11 | 88 | 47.059 | WP_054704956 |
hypothetical protein [Lachnospiraceae bacterium A4] |
8.54e-11 | 86 | 43.939 | WP_157496161 |
hypothetical protein DXB24_23910, partial [Lachnospiraceae bacterium OM02-3] |
9.33e-11 | 87 | 40.299 | RJW54801 |
hypothetical protein [Lachnospiraceae bacterium] |
9.66e-11 | 91 | 47.143 | HBH99868 |
hypothetical protein [Lachnoclostridium sp. An169] hypothetical protein B5F07_10400 [Lachnoclostridium sp. An169] |
1.12e-10 | 77 | 45.763 | WP_087161211 |
hypothetical protein [Hungatella hathewayi] |
1.25e-10 | 71 | 47.273 | WP_147335903 |
3-isopropylmalate dehydrogenase [Clostridiales bacterium TF09-2AC] 3-isopropylmalate dehydrogenase [Clostridiales bacterium TF09-2AC] |
1.31e-10 | 83 | 46.875 | WP_120058570 |
hypothetical protein DXC39_22940 [Hungatella hathewayi] hypothetical protein DWZ48_25545 [Hungatella hathewayi] |
1.45e-10 | 71 | 47.273 | RGL99619 |
hypothetical protein [Eisenbergiella sp. OF01-20] hypothetical protein DXA36_30495 [Eisenbergiella sp. OF01-20] |
1.58e-10 | 87 | 41.791 | WP_118683032 |
hypothetical protein BHV88_23340 [Clostridiales bacterium 41_12_two_minus] hypothetical protein [Lachnospiraceae bacterium] |
1.6e-10 | 79 | 47.541 | OKZ61242 |
hypothetical protein [Lachnospiraceae bacterium] |
1.74e-10 | 77 | 49.153 | HBA49936 |
hypothetical protein [Hungatella hathewayi] hypothetical protein HMPREF9473_03430 [ [Hungatella hathewayi WAL-18680] |
2.03e-10 | 88 | 48.529 | WP_006781420 |
Rpn family recombination-promoting nuclease/putative transposase [Hungatella effluvii] putative transposase/invertase (TIGR01784 family) [Hungatella effluvii] |
2.19e-10 | 71 | 49.091 | WP_110325013 |
hypothetical protein [Eubacteriaceae bacterium] |
2.28e-10 | 78 | 48.333 | WP_148492251 |
hypothetical protein [Clostridiales bacterium] |
2.61e-10 | 82 | 45.312 | HCS75708 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] |
2.76e-10 | 92 | 39.437 | WP_009461483 |
hypothetical protein [Eisenbergiella tayi] hypothetical protein HMPREF0994_04606 [Lachnospiraceae bacterium 3_1_57FAA_CT1] |
3.25e-10 | 86 | 46.970 | WP_009254507 |
hypothetical protein [Eisenbergiella tayi] hypothetical protein BEI62_05120 [Eisenbergiella tayi] |
3.85e-10 | 91 | 38.571 | WP_069422933 |
hypothetical protein [Eisenbergiella tayi] hypothetical protein BEH84_02031 [Eisenbergiella tayi] |
3.85e-10 | 91 | 38.571 | WP_069156721 |
hypothetical protein [Acetatifactor muris] Putative transposase, YhgA-like [Acetatifactor muris] |
4.55e-10 | 91 | 44.286 | WP_103238323 |
hypothetical protein PMF13cell1_03244 [Blautia producta] |
5.41e-10 | 79 | 44.262 | QBE97681 |
hypothetical protein, partial [Eisenbergiella tayi] |
7.25e-10 | 91 | 38.571 | WP_025483256 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] |
7.35e-10 | 95 | 46.154 | WP_095173739 |
hypothetical protein HMPREF0994_03878 [Lachnospiraceae bacterium 3_1_57FAA_CT1] |
7.35e-10 | 91 | 38.571 | EGN38643 |
Rpn family recombination-promoting nuclease/putative transposase [Frisingicoccus caecimuris] putative transposase/invertase (TIGR01784 family) [Frisingicoccus caecimuris] |
7.81e-10 | 82 | 49.206 | WP_132092907 |
hypothetical protein [Lachnospiraceae bacterium 3_1_57FAA_CT1] |
7.9e-10 | 91 | 38.571 | WP_156887106 |
hypothetical protein [Eisenbergiella tayi] hypothetical protein BEH84_00724 [Eisenbergiella tayi] hypothetical protein BLA28_01575 [Eisenbergiella tayi] |
7.99e-10 | 78 | 48.333 | WP_069155767 |
Rpn family recombination-promoting nuclease/putative transposase [Roseburia sp. 499] hypothetical protein BIV20_15650 [Roseburia sp. 499] |
8.12e-10 | 81 | 50.000 | WP_075721945 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] hypothetical protein HMPREF0988_01364 [Lachnospiraceae bacterium 1_4_56FAA] |
8.7e-10 | 79 | 45.902 | WP_009267309 |
3-isopropylmalate dehydrogenase [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
8.8e-10 | 74 | 45.614 | WP_158343351 |
hypothetical protein [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
8.9e-10 | 78 | 48.333 | WP_158342368 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] hypothetical protein DW655_08285 [Lachnospiraceae bacterium AM23-2LB] hypothetical protein DW887_01925 [Lachnospiraceae bacterium AM40-2BH] |
1e-09 | 88 | 42.647 | WP_117550671 |
Rpn family recombination-promoting nuclease/putative transposase [Dorea sp. 5-2] hypothetical protein C817_03326 [Dorea sp. 5-2] |
1.05e-09 | 87 | 41.791 | WP_016220023 |
hypothetical protein BEI61_02078 [Eisenbergiella tayi] |
1.07e-09 | 73 | 48.214 | ODM06189 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia marasmi] |
1.07e-09 | 95 | 41.096 | WP_104802816 |
hypothetical protein [Ruminococcus sp. OM05-10BH] hypothetical protein DXB59_17765 [Ruminococcus sp. OM05-10BH] |
1.25e-09 | 71 | 38.182 | WP_118637968 |
hypothetical protein [Clostridiaceae bacterium MS3] |
1.42e-09 | 91 | 37.143 | WP_044970718 |
hypothetical protein [Lachnospiraceae bacterium] |
1.43e-09 | 90 | 45.455 | HAP21926 |
hypothetical protein HMPREF9477_01255 [Lachnospiraceae bacterium 2_1_46FAA] |
1.45e-09 | 92 | 39.437 | EGG82246 |
MULTISPECIES: hypothetical protein [Lachnospiraceae] hypothetical protein BEI64_32645 [Eisenbergiella tayi] hypothetical protein BEI59_11425 [Eisenbergiella tayi] hypothetical protein BEI63_17115 [Eisenbergiella tayi] Uncharacterised protein [Fusicatenibacter sp. 2789STDY5834925] |
1.51e-09 | 73 | 50.000 | WP_069411359 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] hypothetical protein C3R19_26125 [Blautia producta] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. OF01-4LB] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. AF13-16] |
1.56e-09 | 84 | 46.154 | WP_033142760 |
hypothetical protein CLOSTHATH_03755 [[Clostridium] hathewayi DSM 13479] [Hungatella hathewayi DSM 13479] |
1.58e-09 | 97 | 40.000 | EFC98037 |
Rpn family recombination-promoting nuclease/putative transposase, partial [Lachnoclostridium sp. An169] |
1.68e-09 | 96 | 41.892 | WP_140398002 |
hypothetical protein B5F07_10405 [Lachnoclostridium sp. An169] |
1.68e-09 | 96 | 41.892 | OUP83669 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_32 In bact CP040530.1
Seq (len = 55 ):
MNHFPTQLSGGQCQRVTIARAIIGHPEIILADEPTGNLDSKMGAEVMELLHRLNK
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|297571|-1|5472596-5473175
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
4.537103099711999
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
putative ATP-binding component of ABC transporter [Bacteroides thetaiotaomicron] |
5.05e-32 | 100 | 100.000 | SPU29038 |
ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron VPI-5482] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron VPI-5482] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] |
7.86e-32 | 100 | 100.000 | WP_011107844 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter, ATP-binding protein [Bacteroides sp. 1_1_14] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] |
4.36e-31 | 100 | 98.182 | WP_008762231 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron dnLKV9] aBC transporter ATP-binding protein [Bacteroides thetaiotaomicron CAG:40] ABC transporter ATP-binding protein YtrE [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] |
4.86e-31 | 100 | 98.182 | WP_016267112 |
ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] hypothetical protein BSIG_4824 [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron] |
5.13e-31 | 100 | 98.182 | WP_008764771 |
ATP-binding cassette domain-containing protein, partial [Bacteroides fragilis] |
1.65e-30 | 100 | 94.545 | WP_044820148 |
aBC transporter ATP-binding protein [Bacteroides fragilis CAG:558] |
3.3e-30 | 100 | 94.545 | CCZ38596 |
MULTISPECIES: ABC transporter ATP-binding protein [unclassified Bacteroides] hypothetical protein BSGG_3290 [Bacteroides sp. D2] ABC transporter ATP-binding protein [Bacteroides sp. OM05-10AA] ABC transporter ATP-binding protein [Bacteroides sp. AF27-33] ABC transporter ATP-binding protein [Bacteroides sp. AF26-7BH] ABC transporter ATP-binding protein [Bacteroides sp. OF02-3LB] |
4.02e-30 | 100 | 96.364 | WP_008999908 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] hypothetical protein HMPREF1068_03347 [Bacteroides nordii CL02T12C05] ABC transporter ATP-binding protein [Bacteroides sp. HPS0048] macrolide ABC transporter ATP-binding protein [Bacteroides sp. 41_26] ABC transporter ATP-binding protein [Bacteroides nordii] |
4.88e-30 | 100 | 94.545 | WP_002561385 |
ABC transporter ATP-binding protein [Bacteroides faecis] ABC transporter ATP-binding protein [Bacteroides faecis] ABC transporter ATP-binding protein [Bacteroides faecis] ABC transporter ATP-binding protein [Bacteroides faecis] |
4.99e-30 | 100 | 94.545 | WP_138337034 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] aBC transporter ATP-binding protein [Bacteroides faecis CAG:32] putative ABC transport system ATP-binding protein [Bacteroides faecis MAJ27] ABC transporter ATP-binding protein [Bacteroides faecis] ABC transporter ATP-binding protein [Bacteroides faecis] ABC transporter ATP-binding protein [Bacteroides faecis] |
5.21e-30 | 100 | 94.545 | WP_010538779 |
ABC transporter ATP-binding protein [Bacteroides acidifaciens] uncharacterized protein BN772_01421 [Bacteroides sp. CAG:754] |
7.21e-30 | 100 | 94.545 | WP_022137867 |
ABC transporter ATP-binding protein [Bacteroides congonensis] |
8.03e-30 | 100 | 94.545 | WP_073343266 |
ABC transporter ATP-binding protein, partial [Bacteroides fragilis] |
1.22e-29 | 100 | 94.545 | WP_134994699 |
ABC transporter ATP-binding protein, partial [Bacteroides fragilis] |
2.71e-29 | 100 | 94.545 | WP_044820110 |
ABC transporter ATP-binding protein [Bacteroides fragilis] hypothetical protein HMPREF1018_01607 [Bacteroides fragilis] |
2.88e-29 | 100 | 94.545 | WP_009291927 |
macrolide ABC transporter ATP-binding protein [Bacteroides fragilis] |
3.12e-29 | 100 | 94.545 | OCR36401 |
ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [uncultured bacterium 16f15] hypothetical protein HMPREF1055_01407 [Bacteroides fragilis CL07T00C01] hypothetical protein HMPREF1056_01515 [Bacteroides fragilis CL07T12C05] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #8] ABC transporter family protein [Bacteroides fragilis str. 3397 T10] ABC transporter family protein [Bacteroides fragilis str. 3774 T13] ABC transporter family protein [Bacteroides fragilis str. 3986 N(B)19] ABC transporter family protein [Bacteroides fragilis str. Ds-233] ABC transporter family protein [Bacteroides fragilis str. S13 L11] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #4] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #7] ABC transporter family protein [Bacteroides fragilis str. 3397 N2] ABC transporter family protein [Bacteroides fragilis str. 3397 T14] ABC transporter family protein [Bacteroides fragilis str. 3725 D9(v)] ABC transporter family protein [Bacteroides fragilis str. 3976T8] ABC transporter family protein [Bacteroides fragilis str. 3-F-2 #6] ABC transporter family protein [Bacteroides fragilis str. B1 (UDC16-1)] ABC transporter family protein [Bacteroides fragilis str. S23 R14] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #10] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #3] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #9] ABC transporter family protein [Bacteroides fragilis str. 3397 N3] ABC transporter family protein [Bacteroides fragilis str. S23L24] ABC transporter family protein [Bacteroides fragilis str. S24L15] ABC transporter family protein [Bacteroides fragilis str. S24L26] ABC transporter family protein [Bacteroides fragilis str. S24L34] ABC transporter family protein [Bacteroides fragilis str. S23L17] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #5] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #6] |
3.14e-29 | 100 | 94.545 | WP_005795276 |
ABC transporter ATP-binding protein [Bacteroides sp. OF03-11BH] ABC transporter ATP-binding protein [Bacteroides ovatus] ABC transporter ATP-binding protein [Bacteroides sp. OF03-11BH] |
3.18e-29 | 100 | 94.545 | WP_120079820 |
ABC transporter ATP-binding protein, partial [Bacteroides fragilis] |
3.22e-29 | 100 | 94.545 | WP_057059446 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter ATP-binding protein [Bacteroides fragilis YCH46] hypothetical protein HMPREF1067_03787 [Bacteroides fragilis CL03T12C07] hypothetical protein HMPREF1066_01498 [Bacteroides fragilis CL03T00C08] hypothetical protein HMPREF1079_00646 [Bacteroides fragilis CL05T00C42] hypothetical protein HMPREF1080_01448 [Bacteroides fragilis CL05T12C13] hypothetical protein HMPREF1204_03273 [Bacteroides fragilis HMW 615] ABC transporter family protein [Bacteroides fragilis str. 2-F-2 #5] ABC transporter family protein [Bacteroides fragilis str. 2-F-2 #7] ABC transporter family protein [Bacteroides fragilis str. 34-F-2 #13] ABC transporter family protein [Bacteroides fragilis str. 3783N1-2] ABC transporter family protein [Bacteroides fragilis str. 3783N2-1] ABC transporter family protein [Bacteroides fragilis str. 3976T7] ABC transporter family protein [Bacteroides fragilis str. 3986T(B)10] ABC transporter family protein [Bacteroides fragilis str. 3986 T(B)9] ABC transporter family protein [Bacteroides fragilis str. 3988T(B)14] ABC transporter family protein [Bacteroides fragilis str. 3988 T1] ABC transporter family protein [Bacteroides fragilis str. 3996 N(B) 6] ABC transporter family protein [Bacteroides fragilis str. 3998T(B)3] ABC transporter family protein [Bacteroides fragilis str. 3998 T(B) 4] ABC transporter family protein [Bacteroides fragilis str. DS-166] ABC transporter family protein [Bacteroides fragilis str. DS-208] ABC transporter family protein [Bacteroides fragilis str. DS-71] ABC transporter family protein [Bacteroides fragilis str. S36L11] ABC transporter family protein [Bacteroides fragilis str. 2-F-2 #4] ABC transporter family protein [Bacteroides fragilis str. 3719 A10] ABC transporter family protein [Bacteroides fragilis str. 3783N1-8] ABC transporter family protein [Bacteroides fragilis str. J38-1] ABC transporter family protein [Bacteroides fragilis str. Korea 419] ABC transporter family protein [Bacteroides fragilis str. S6L3] ABC transporter family protein [Bacteroides fragilis str. S6R6] ABC transporter family protein [Bacteroides fragilis str. 1009-4-F #10] ABC transporter family protein [Bacteroides fragilis str. 1009-4-F #7] ABC transporter family protein [Bacteroides fragilis str. 20793-3] ABC transporter family protein [Bacteroides fragilis str. 3719 T6] ABC transporter family protein [Bacteroides fragilis str. 3986 N(B)22] ABC transporter family protein [Bacteroides fragilis str. 3986 T(B)13] ABC transporter family protein [Bacteroides fragilis str. A7 (UDC12-2)] ABC transporter family protein [Bacteroides fragilis str. S36L12] ABC transporter family protein [Bacteroides fragilis str. S36L5] ABC transporter family protein [Bacteroides fragilis str. S38L5] ABC transporter family protein [Bacteroides fragilis str. S6L8] ABC transporter family protein [Bacteroides fragilis str. S6R5] ABC transporter family protein [Bacteroides fragilis str. 3783N1-6] ABC transporter family protein [Bacteroides fragilis str. S38L3] ABC transporter family protein [Bacteroides fragilis str. I1345] ABC transporter family protein [Bacteroides fragilis str. S6L5] ABC transporter family protein [Bacteroides fragilis str. S6R8] ABC transporter family protein [Bacteroides fragilis str. 3986 N3] putative ABC transport system ATP-binding protein [Bacteroides fragilis NCTC 9343] putative ABC transport system ATP-binding protein [Bacteroides fragilis 638R] aBC transporter ATP-binding protein [Bacteroides fragilis CAG:47] |
3.24e-29 | 100 | 94.545 | WP_005786290 |
ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter family protein [Bacteroides fragilis str. J-143-4] |
3.24e-29 | 100 | 94.545 | WP_032564451 |
ABC transporter ATP-binding protein [Bacteroides fragilis] |
3.34e-29 | 100 | 94.545 | WP_049129684 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] putative ABC transport system ATP-binding protein [Bacteroides ovatus] putative ABC transport system ATP-binding protein [Bacteroides ovatus] |
3.35e-29 | 100 | 94.545 | WP_074560344 |
MULTISPECIES: ATP-binding cassette domain-containing protein [unclassified Bacteroides] ATP-binding cassette domain-containing protein [Bacteroides sp. HF-5141] ABC transporter ATP-binding protein [Bacteroides sp. HF-5092] |
3.35e-29 | 100 | 94.545 | WP_143259507 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter, ATP-binding protein [Bacteroides ovatus ATCC 8483] hypothetical protein HMPREF1017_01933 [Bacteroides ovatus 3_8_47FAA] hypothetical protein HMPREF1070_04162 [Bacteroides ovatus CL03T12C18] hypothetical protein HMPREF1069_03334 [Bacteroides ovatus CL02T12C04] ABC transporter family protein [Bacteroides ovatus str. 3725 D1 iv] ABC transporter family protein [Bacteroides fragilis str. 3725 D9 ii] ABC transporter family protein [Bacteroides ovatus str. 3725 D9 iii] uncharacterized protein BN541_03822 [Bacteroides ovatus CAG:22] Uncharacterized ABC transporter ATP-binding protein MJ1508 [Bacteroides ovatus V975] |
3.54e-29 | 100 | 94.545 | WP_004300704 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter, ATP-binding protein [Bacteroides fragilis 3_1_12] hypothetical protein HMPREF1205_02930 [Bacteroides fragilis HMW 616] hypothetical protein HMPREF1203_02578 [Bacteroides fragilis HMW 610] macrolide ABC transporter ATP-binding protein [Bacteroides fragilis] macrolide ABC transporter ATP-binding protein [Bacteroides fragilis] |
3.54e-29 | 100 | 94.545 | WP_005776280 |
ABC transporter ATP-binding protein [Bacteroides sp. CF01-10NS] ABC transporter ATP-binding protein [Bacteroides sp. CF01-10NS] |
3.58e-29 | 100 | 94.545 | WP_128858396 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] hypothetical protein HMPREF1205_02929 [Bacteroides fragilis HMW 616] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] |
3.58e-29 | 100 | 94.545 | WP_005819156 |
ABC transporter ATP-binding protein [Bacteroides ovatus] |
3.62e-29 | 100 | 94.545 | RGZ53513 |
ABC transporter ATP-binding protein [Bacteroides xylanisolvens] ABC transporter ATP-binding protein [Bacteroides ovatus] ABC transporter ATP-binding protein [Bacteroides ovatus] putative ABC transport system ATP-binding protein [Bacteroides xylanisolvens] |
3.65e-29 | 100 | 94.545 | WP_074705526 |
ABC transporter ATP-binding protein [Bacteroides ovatus] |
3.73e-29 | 100 | 94.545 | KAA3989064 |
ABC transporter ATP-binding protein [Bacteroides fragilis] hypothetical protein HMPREF1203_02579 [Bacteroides fragilis HMW 610] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] aBC transporter ATP-binding protein [Bacteroides fragilis CAG:558] |
3.78e-29 | 100 | 94.545 | WP_005809433 |
ABC transporter ATP-binding protein [Bacteroides xylanisolvens] putative ATP-binding component of ABC transporter [Bacteroides xylanisolvens] putative ABC transport system ATP-binding protein [Bacteroides xylanisolvens] |
3.78e-29 | 100 | 94.545 | WP_055235355 |
ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter, ATP-binding protein [Bacteroides fragilis 3_1_12] macrolide ABC transporter ATP-binding protein [Bacteroides fragilis] macrolide ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] |
3.82e-29 | 100 | 94.545 | WP_005776276 |
ABC transporter ATP-binding protein [Bacteroides sp. 3_1_23] ABC transporter, ATP-binding protein [Bacteroides sp. 3_1_23] |
4.12e-29 | 100 | 94.545 | WP_008648752 |
ATP-binding cassette domain-containing protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] |
4.21e-29 | 100 | 94.545 | WP_149919773 |
ABC transporter ATP-binding protein [Bacteroides fragilis] macrolide ABC transporter ATP-binding protein [Bacteroides fragilis] |
4.21e-29 | 100 | 94.545 | WP_101602930 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter ATP-binding protein [Bacteroides fragilis YCH46] hypothetical protein HMPREF1055_01410 [Bacteroides fragilis CL07T00C01] hypothetical protein HMPREF1067_03790 [Bacteroides fragilis CL03T12C07] hypothetical protein HMPREF1066_01495 [Bacteroides fragilis CL03T00C08] hypothetical protein HMPREF1079_00649 [Bacteroides fragilis CL05T00C42] hypothetical protein HMPREF1056_01512 [Bacteroides fragilis CL07T12C05] hypothetical protein HMPREF1080_01445 [Bacteroides fragilis CL05T12C13] hypothetical protein HMPREF1204_03270 [Bacteroides fragilis HMW 615] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #8] ABC transporter family protein [Bacteroides fragilis str. 2-F-2 #5] ABC transporter family protein [Bacteroides fragilis str. 2-F-2 #7] ABC transporter family protein [Bacteroides fragilis str. 34-F-2 #13] ABC transporter family protein [Bacteroides fragilis str. 3986T(B)10] ABC transporter family protein [Bacteroides fragilis str. 3986 N(B)19] ABC transporter family protein [Bacteroides fragilis str. 3986 T(B)9] ABC transporter family protein [Bacteroides fragilis str. 3996 N(B) 6] ABC transporter family protein [Bacteroides fragilis str. 3998T(B)3] ABC transporter family protein [Bacteroides fragilis str. 3998 T(B) 4] ABC transporter family protein [Bacteroides fragilis str. DS-166] ABC transporter family protein [Bacteroides fragilis str. DS-208] ABC transporter family protein [Bacteroides fragilis str. DS-71] ABC transporter family protein [Bacteroides fragilis str. Ds-233] ABC transporter family protein [Bacteroides fragilis str. J-143-4] ABC transporter family protein [Bacteroides fragilis str. S13 L11] ABC transporter family protein [Bacteroides fragilis str. S36L11] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #4] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #7] ABC transporter family protein [Bacteroides fragilis str. 2-F-2 #4] ABC transporter family protein [Bacteroides fragilis str. 3719 A10] ABC transporter family protein [Bacteroides fragilis str. 3725 D9(v)] ABC transporter family protein [Bacteroides fragilis str. 3976T8] ABC transporter family protein [Bacteroides fragilis str. 3-F-2 #6] ABC transporter family protein [Bacteroides fragilis str. B1 (UDC16-1)] ABC transporter family protein [Bacteroides fragilis str. J38-1] ABC transporter family protein [Bacteroides fragilis str. Korea 419] ABC transporter family protein [Bacteroides fragilis str. S23 R14] ABC transporter family protein [Bacteroides fragilis str. S6L3] ABC transporter family protein [Bacteroides fragilis str. S6R6] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #10] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #3] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #9] ABC transporter family protein [Bacteroides fragilis str. 1009-4-F #10] ABC transporter family protein [Bacteroides fragilis str. 1009-4-F #7] ABC transporter family protein [Bacteroides fragilis str. 20793-3] ABC transporter family protein [Bacteroides fragilis str. 3719 T6] ABC transporter family protein [Bacteroides fragilis str. 3986 N(B)22] ABC transporter family protein [Bacteroides fragilis str. 3986 T(B)13] ABC transporter family protein [Bacteroides fragilis str. A7 (UDC12-2)] ABC transporter family protein [Bacteroides fragilis str. S23L24] ABC transporter family protein [Bacteroides fragilis str. S24L15] ABC transporter family protein [Bacteroides fragilis str. S24L26] ABC transporter family protein [Bacteroides fragilis str. S24L34] ABC transporter family protein [Bacteroides fragilis str. S36L12] ABC transporter family protein [Bacteroides fragilis str. S36L5] ABC transporter family protein [Bacteroides fragilis str. S38L5] ABC transporter family protein [Bacteroides fragilis str. S6L8] ABC transporter family protein [Bacteroides fragilis str. S6R5] ABC transporter family protein [Bacteroides fragilis str. S38L3] ABC transporter family protein [Bacteroides fragilis str. I1345] ABC transporter family protein [Bacteroides fragilis str. S23L17] ABC transporter family protein [Bacteroides fragilis str. S6L5] ABC transporter family protein [Bacteroides fragilis str. S6R8] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #5] ABC transporter family protein [Bacteroides fragilis str. 1007-1-F #6] ABC transporter family protein [Bacteroides fragilis str. 3986 N3] putative ATP-binding component of ABC transporter [Bacteroides fragilis NCTC 9343] putative ATP-binding component of ABC transporter [Bacteroides fragilis 638R] |
4.49e-29 | 100 | 94.545 | WP_005786282 |
ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter family protein [Bacteroides fragilis str. 3988T(B)14] ABC transporter family protein [Bacteroides fragilis str. 3988 T1] aBC transporter ATP-binding protein [Bacteroides fragilis CAG:47] ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [Bacteroides fragilis] |
4.89e-29 | 100 | 94.545 | WP_022348495 |
ABC transporter ATP-binding protein [Bacteroides fragilis] |
4.98e-29 | 100 | 94.545 | WP_049129899 |
ABC transporter ATP-binding protein [Bacteroides fragilis] |
5.11e-29 | 100 | 94.545 | RHM62090 |
ABC transporter ATP-binding protein [Bacteroides fragilis] ABC transporter ATP-binding protein [uncultured bacterium 16f15] ABC transporter family protein [Bacteroides fragilis str. 3397 T10] ABC transporter family protein [Bacteroides fragilis str. 3774 T13] ABC transporter family protein [Bacteroides fragilis str. 3783N1-2] ABC transporter family protein [Bacteroides fragilis str. 3783N2-1] ABC transporter family protein [Bacteroides fragilis str. 3976T7] ABC transporter family protein [Bacteroides fragilis str. 3397 N2] ABC transporter family protein [Bacteroides fragilis str. 3397 T14] ABC transporter family protein [Bacteroides fragilis str. 3783N1-8] ABC transporter family protein [Bacteroides fragilis str. 3397 N3] ABC transporter family protein [Bacteroides fragilis str. 3783N1-6] |
5.11e-29 | 100 | 94.545 | WP_032528501 |
ABC transporter ATP-binding protein [Bacteroides salyersiae] hypothetical protein HMPREF1071_03653 [Bacteroides salyersiae CL02T12C01] hypothetical protein HMPREF1532_02742 [Bacteroides salyersiae WAL 10018 = DSM 18765 = JCM 12988] ABC transporter ATP-binding protein [Bacteroides salyersiae] ABC transporter ATP-binding protein [Bacteroides salyersiae] ABC transporter ATP-binding protein [Bacteroides salyersiae] |
5.88e-29 | 100 | 92.727 | WP_005930364 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] macrolide ABC transporter ATP-binding protein [Bacteroides caecimuris] ABC transporter ATP-binding protein [Bacteroides caecimuris] ABC transporter ATP-binding protein [Bacteroides caecimuris] ABC transporter ATP-binding protein [Bacteroides caecimuri] |
7.46e-29 | 100 | 92.727 | WP_065539038 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] hypothetical protein HMPREF0127_04002 [Bacteroides sp. 1_1_30] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] macrolide ABC transporter ATP-binding protein [Bacteroides xylanisolvens] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] |
8.23e-29 | 100 | 92.727 | WP_008644652 |
ABC transporter ATP-binding protein [Bacteroides xylanisolvens] macrolide ABC transporter ATP-binding protein [Bacteroides xylanisolvens] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] |
8.5e-29 | 100 | 92.727 | WP_087321920 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter, ATP-binding protein [Bacteroides xylanisolvens SD CC 2a] ABC transporter, ATP-binding protein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein HMPREF1074_04102 [Bacteroides xylanisolvens CL03T12C04] ABC transporter, ATP-binding protein [Bacteroides sp. D1] ABC transporter, ATP-binding protein [Bacteroides sp. 2_1_22] |
8.78e-29 | 100 | 92.727 | WP_004314289 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter, ATP-binding protein [Bacteroides ovatus SD CMC 3f] ABC-type antimicrobial peptide transport system, ATPase component [Bacteroides xylanisolvens XB1A] ABC transporter, ATP-binding protein [Bacteroides sp. 2_2_4] ABC transporter, ATP-binding protein [Bacteroides sp. D22] ABC transporter ATP-binding protein [Bacteroides ovatus] |
9.07e-29 | 100 | 92.727 | WP_004311327 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] ABC transporter ATP-binding protein [Bacteroides xylanisolvens] hypothetical protein HMPREF9009_02600 [Bacteroides sp. 3_1_13] |
9.57e-29 | 100 | 92.727 | WP_049702436 |
ABC transporter ATP-binding protein [Bacteroides ovatus] |
1.09e-28 | 100 | 92.727 | RHK35319 |
MULTISPECIES: ABC transporter ATP-binding protein [unclassified Bacteroides] ABC transporter ATP-binding protein [Bacteroides sp. OM05-12] ABC transporter ATP-binding protein [Bacteroides sp. AF16-49] |
1.54e-28 | 100 | 90.909 | WP_122125533 |
ATP-binding cassette domain-containing protein, partial [Bacteroides stercoris] ABC transporter ATP-binding protein, partial [Bacteroides stercoris] |
1.6e-28 | 100 | 92.727 | WP_151872035 |
ATP-binding cassette domain-containing protein [Parabacteroides merdae] |
1.67e-28 | 100 | 89.091 | MTT26462 |
ABC transporter ATP-binding protein [Bacteroides fragilis] macrolide ABC transporter ATP-binding protein [Bacteroides fragilis] |
2.4e-28 | 100 | 92.727 | WP_065763351 |
ABC transporter, ATP-binding protein [Bacteroides caccae ATCC 43185] |
2.65e-28 | 100 | 89.091 | EDM20175 |
ABC transporter ATP-binding protein [Bacteroides fragilis] |
3.01e-28 | 100 | 92.727 | RGZ84139 |
ABC transporter ATP-binding protein [Bacteroides neonati] |
3.62e-28 | 100 | 89.091 | WP_042367675 |
ABC transporter ATP-binding protein [Prevotella oryzae] ABC-type antimicrobial peptide transport system, ATPase component [Prevotella oryzae DSM 17970] |
3.86e-28 | 100 | 90.909 | WP_036875908 |
ABC transporter ATP-binding protein [Prevotella paludivivens] |
4.03e-28 | 100 | 90.909 | WP_018464490 |
ABC transporter ATP-binding protein [Bacteroides heparinolyticus] ABC transporter related protein [Bacteroides heparinolyticus] |
4.08e-28 | 100 | 92.727 | WP_131751320 |
ABC transporter ATP-binding protein [Bacteroides caccae] ABC transporter ATP-binding protein [Bacteroides caccae] |
4.17e-28 | 100 | 89.091 | WP_055173449 |
ABC transporter ATP-binding protein [Bacteroides caccae] hypothetical protein HMPREF1061_02583 [Bacteroides caccae CL03T12C61] macrolide ABC transporter ATP-binding protein [Bacteroides sp. 43_46] uncharacterized protein BN535_01368 [Bacteroides caccae CAG:21] ABC transporter ATP-binding protein [Bacteroides caccae] ABC transporter ATP-binding protein [Bacteroides caccae] |
4.35e-28 | 100 | 89.091 | WP_005681524 |
ABC transporter ATP-binding protein [Bacteroides pyogenes] ABC transporter, ATP-binding protein [Bacteroides pyogenes F0041] ABC transporter ATP-binding protein [Bacteroides pyogenes DSM 20611 = JCM 6294] ABC transporter ATP-binding protein [Bacteroides pyogenes] ABC transporter ATP-binding protein [Bacteroides pyogenes] ABC transporter ATP-binding protein [Bacteroides pyogenes] |
4.45e-28 | 100 | 89.091 | WP_021645442 |
ABC transporter ATP-binding protein [Parabacteroides merdae] ABC transporter, ATP-binding protein [Parabacteroides merdae ATCC 43184] hypothetical protein HMPREF1060_02811 [Parabacteroides merdae CL03T12C32] hypothetical protein HMPREF1078_02959 [Parabacteroides merdae CL09T00C40] ATP-binding cassette domain-containing protein [Escherichia coli] macrolide ABC transporter ATP-binding protein [Parabacteroides sp. merdae-related_45_40] aBC transporter ATP-binding protein [Parabacteroides merdae CAG:48] |
4.5e-28 | 100 | 89.091 | WP_005636316 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] macrolide ABC transporter ATP-binding protein [Bacteroides zoogleoformans] macrolide ABC transporter ATP-binding protein [Bacteroides heparinolyticus] putative ABC transport system ATP-binding protein [Bacteroides zoogleoformans] |
4.54e-28 | 100 | 92.727 | WP_106040656 |
ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] |
4.59e-28 | 100 | 92.727 | WP_117899334 |
ABC transporter ATP-binding protein [Parabacteroides merdae] ABC transporter ATP-binding protein [Parabacteroides merdae] |
4.59e-28 | 100 | 89.091 | WP_119215470 |
ABC transporter ATP-binding protein [Bacteroides stercoris] putative ABC transporter ATP-binding protein, YtrE-like [Bacteroides stercoris] |
4.69e-28 | 100 | 92.727 | WP_060386129 |
MULTISPECIES: ABC transporter ATP-binding protein [unclassified Parabacteroides] ABC transporter ATP-binding protein [Parabacteroides sp. AF48-14] ABC transporter ATP-binding protein [Parabacteroides sp. AF17-28] |
4.96e-28 | 100 | 89.091 | WP_122332956 |
ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] |
5.06e-28 | 100 | 92.727 | WP_117906439 |
ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] |
5.06e-28 | 100 | 92.727 | WP_117665320 |
ABC transporter ATP-binding protein [Bacteroides heparinolyticus] ABC transporter ATP-binding protein [Bacteroides heparinolyticus] |
5.06e-28 | 100 | 92.727 | WP_125238449 |
ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter, ATP-binding protein [Bacteroides stercoris ATCC 43183] ABC transporter ATP-binding protein [Bacteroides stercoris CC31F] aBC transporter ATP-binding protein [Bacteroides stercoris CAG:120] ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] |
5.12e-28 | 100 | 92.727 | WP_005653140 |
ABC transporter ATP-binding protein [Bacteroides ovatus] |
5.29e-28 | 100 | 92.727 | KAA4280009 |
ABC transporter ATP-binding protein [Parabacteroides johnsonii] ABC transporter, ATP-binding protein [Parabacteroides johnsonii DSM 18315] hypothetical protein HMPREF1077_00695 [Parabacteroides johnsonii CL02T12C29] macrolide ABC transporter ATP-binding protein [Parabacteroides johnsonii] putative uncharacterized protein [Parabacteroides johnsonii CAG:246] |
5.58e-28 | 100 | 89.091 | WP_008148880 |
ABC transporter ATP-binding protein [Bacteroides heparinolyticus] putative ABC transport system ATP-binding protein [Bacteroides heparinolyticus] |
5.76e-28 | 100 | 92.727 | WP_131926373 |
ABC transporter related protein [Bacteroides caccae] ABC transporter related protein [Bacteroides caccae] |
6.16e-28 | 100 | 89.091 | CUP87766 |
ABC transporter ATP-binding protein [Bacteroides fragilis] hypothetical protein HMPREF1018_01604 [Bacteroides fragilis] |
1.03e-27 | 100 | 92.727 | WP_009291926 |
macrolide ABC transporter ATP-binding protein [Bacteroidia bacterium 44-10] |
1.1e-27 | 100 | 89.091 | OJV87308 |
ABC transporter ATP-binding protein [Parabacteroides massiliensis] |
1.18e-27 | 100 | 87.273 | WP_075967357 |
ABC transporter ATP-binding protein [Parabacteroides acidifaciens] ABC transporter ATP-binding protein [Parabacteroides acidifaciens] |
1.22e-27 | 100 | 89.091 | WP_115498156 |
macrolide ABC transporter ATP-binding protein [Porphyromonadaceae bacterium] |
1.28e-27 | 100 | 89.091 | HBU46346 |
ABC transporter ATP-binding protein [Parabacteroides merdae] ATP-binding cassette domain-containing protein [Parabacteroides merdae] ATP-binding cassette domain-containing protein [Parabacteroides merdae] ATP-binding cassette domain-containing protein [Parabacteroides merdae] ATP-binding cassette domain-containing protein [Parabacteroides merdae] ATP-binding cassette domain-containing protein [Parabacteroides merdae] |
1.33e-27 | 100 | 89.091 | WP_122298153 |
aBC transporter ATP-binding protein [Parabacteroides sp. CAG:409] |
1.33e-27 | 100 | 89.091 | CDE60699 |
ABC transporter ATP-binding protein [Bacteroides sartorii] |
1.42e-27 | 100 | 89.091 | EOS11871 |
ATP-binding cassette domain-containing protein [Parabacteroides merdae] ATP-binding cassette domain-containing protein [Parabacteroides merdae] |
1.44e-27 | 100 | 89.091 | WP_155152016 |
ABC transporter ATP-binding protein [Bacteroides sartorii] ABC transporter ATP-binding protein [Bacteroides sartorii] |
1.61e-27 | 100 | 89.091 | WP_025017931 |
ABC transporter ATP-binding protein [Bacteroides sp. 9_1_42FAA] |
1.82e-27 | 100 | 89.091 | EEO61416 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter family protein [Bacteroides vulgatus str. 3975 RP4] ABC transporter ATP-binding protein [Bacteroides sp.] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] |
1.89e-27 | 100 | 89.091 | WP_032952588 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter family protein [Bacteroides vulgatus str. 3775 SR(B) 19] ABC transporter family protein [Bacteroides vulgatus str. 3775 SL(B) 10 (iv)] ABC transporter ATP-binding protein [Bacteroides sp.] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] |
1.89e-27 | 100 | 89.091 | WP_032934722 |
ABC transporter ATP-binding protein [Bacteroides sp. 9_1_42FAA] |
1.91e-27 | 100 | 89.091 | WP_008673674 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] ABC transporter ATP-binding protein [Bacteroides sp. 3_1_40A] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] |
1.96e-27 | 100 | 89.091 | WP_008781947 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] macrolide ABC transporter ATP-binding protein [Bacteroides dorei CL03T12C01] macrolide ABC transporter ATP-binding protein [Bacteroides dorei] macrolide ABC transporter ATP-binding protein [Bacteroides dorei] macrolide ABC transporter ATP-binding protein [Bacteroides dorei] ABC transporter, ATP-binding protein [Bacteroides sp. 3_1_33FAA] |
1.96e-27 | 100 | 89.091 | WP_008652798 |
ABC transporter ATP-binding protein [Bacteroides dorei] macrolide ABC transporter ATP-binding protein [Bacteroides dorei] |
1.96e-27 | 100 | 89.091 | WP_087336844 |
ABC transporter ATP-binding protein [Bacteroides vulgatus ATCC 8482] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter, ATP-binding protein [Bacteroides vulgatus PC510] hypothetical protein HMPREF1058_00734 [Bacteroides vulgatus CL09T03C04] ABC transporter ATP-binding protein [Bacteroides vulgatus dnLKV7] aBC transporter ATP-binding protein [Bacteroides vulgatus CAG:6] |
1.98e-27 | 100 | 89.091 | ABR40005 |
MULTISPECIES: ABC transporter ATP-binding protein [Bacteroides] macrolide ABC transporter ATP-binding protein [Bacteroides sp.] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] ABC transporter ATP-binding protein [Bacteroides vulgatus] |
2.02e-27 | 100 | 89.091 | WP_117873196 |
ABC transporter, ATP-binding protein [Bacteroides sp. 4_3_47FAA] putative ABC transport system ATP-binding protein [Bacteroides vulgatus] |
2.03e-27 | 100 | 89.091 | EET15710 |
putative ABC transporter ATP-binding protein, YtrE-like [Bacteroides vulgatus] putative ABC transporter ATP-binding protein, YtrE-like [Bacteroides vulgatus] putative ABC transporter ATP-binding protein, YtrE-like [Bacteroides vulgatus] |
2.05e-27 | 100 | 89.091 | RIB33430 |
ABC transporter ATP-binding protein [Bacteroides stercoris] ABC transporter ATP-binding protein [Bacteroides stercoris] |
2.06e-27 | 100 | 90.909 | WP_118939638 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_33 In blautia CP039126.1
Seq (len = 325 ):
MGKGGVSDSERIRRALARTSISPVLRFSFTAPERASTRPVTAITNSLLSLPAFSKPSSSISPFSKMICMIPERSRKSTKTIPPLLRLFCTQPIRVTVLPISAFVTSVHLWVLFNPFIDSAIVSVLLHFLVVYLFDDFISLCHKLFFLEFFVLLHVYNIYILTGISLFSGLLHDLDQLFGTQLLIQQICFFVRAARNLESSLHEQHYNTLKTNRKSGCRSRGSCKFADHFIITSAAAYAAGKAVDADLKNRSCVIRHTAHQCGVEHDPEVGCLSLCHALNDGGHIVCHIRVQEAFQLFFTIIHTVNAFSDGLKQCNIFVNTFFGKS
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|135079|1|3588235-3589255
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.496981476973908
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 40 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein HMPREF0106_02423 [Bacteroides sp. D22] hypothetical protein BXY_39070 [Bacteroides xylanisolvens XB1A] Uncharacterised protein [Bacteroides xylanisolvens] |
3.45e-32 | 100 | 100.000 | EFI13405 |
hypothetical protein DXD25_16125 [Prevotella sp. TF12-30] |
7.77e-21 | 84 | 83.333 | RGK21418 |
hypothetical protein PREVCOP_04998 [Prevotella copri DSM 18205] |
1.92e-20 | 84 | 83.333 | EFB35332 |
hypothetical protein [Bacteroides helcogenes] hypothetical protein Bache_0436 [Bacteroides helcogenes P 36-108] |
1.79e-15 | 84 | 72.917 | WP_013546080 |
hypothetical protein [Prevotellaceae bacterium] |
5.15e-15 | 84 | 68.750 | HAE24163 |
hypothetical protein [Bacteroides timonensis] |
5.57e-14 | 84 | 68.750 | WP_044269767 |
Uncharacterised protein [uncultured Bacteroides sp.] |
3.41e-13 | 86 | 65.306 | SCH41663 |
hypothetical protein HMPREF1070_03673 [Bacteroides ovatus CL03T12C18] Uncharacterised protein [Bacteroides ovatus] hypothetical protein SAMN05216250_102120 [Bacteroides xylanisolvens] |
6.31e-13 | 86 | 69.388 | EIY62806 |
hypothetical protein BSAG_02590 [Bacteroides sp. D1] hypothetical protein HMPREF0102_01924 [Bacteroides sp. 2_1_22] conserved domain protein [Bacteroides xylanisolvens SD CC 2a] conserved domain protein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein BN891_30020 [Bacteroides xylanisolvens SD CC 2a] |
7.53e-13 | 86 | 67.347 | EEO50879 |
hypothetical protein [Bacteroides intestinalis] hypothetical protein DW712_12445 [Bacteroides intestinalis] |
9.4e-13 | 86 | 65.306 | WP_118222275 |
hypothetical protein Bache_0431 [Bacteroides helcogenes P 36-108] |
1.39e-12 | 86 | 67.347 | ADV42458 |
hypothetical protein HMPREF1017_04113 [Bacteroides ovatus 3_8_47FAA] |
1.44e-12 | 86 | 69.388 | EGM99627 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein F3F30_15925 [Bacteroides ovatus] hypothetical protein F3F24_16790 [Bacteroides ovatus] hypothetical protein F3D74_15860 [Bacteroides ovatus] hypothetical protein F3D72_15925 [Bacteroides ovatus] hypothetical protein F3D65_06530 [Bacteroides ovatus] |
1.48e-12 | 86 | 69.388 | WP_080598062 |
hypothetical protein [Bacteroides intestinalis] hypothetical protein DWW10_15170 [Bacteroides intestinalis] hypothetical protein DW932_16535 [Bacteroides intestinalis] |
1.88e-12 | 86 | 65.306 | WP_118421745 |
Uncharacterised protein [Bacteroides thetaiotaomicron] Uncharacterised protein [Bacteroides thetaiotaomicron] hypothetical protein SAMN02910322_01444 [Bacteroides thetaiotaomicron] hypothetical protein SAMN02910431_01943 [Bacteroides sp. AR20] |
2.16e-12 | 86 | 67.347 | CUM88257 |
hypothetical protein HMPREF0106_00200 [Bacteroides sp. D22] |
3.58e-12 | 86 | 67.347 | EFI15726 |
hypothetical protein SAMN05444350_13250 [Bacteroides stercorirosoris] |
7.07e-12 | 86 | 65.306 | SHJ50972 |
hypothetical protein [Bacteroides sp. D22] hypothetical protein F3B90_14315 [Bacteroides ovatus] hypothetical protein F3B52_15510 [Bacteroides ovatus] hypothetical protein F3B42_12750 [Bacteroides ovatus] hypothetical protein F3B41_14570 [Bacteroides ovatus] |
1.12e-11 | 86 | 67.347 | WP_083787876 |
hypothetical protein Btheta7330_00927 [Bacteroides thetaiotaomicron] hypothetical protein C799_02701 [Bacteroides thetaiotaomicron dnLKV9] hypothetical protein BSIG_3292 [Bacteroides thetaiotaomicron] hypothetical protein HMPREF2534_01591 [Bacteroides thetaiotaomicron] hypothetical protein EH213_01274 [Bacteroides thetaiotaomicron] |
1.29e-11 | 86 | 65.306 | ALJ40503 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein DWY71_08630 [Bacteroides sp. AF26-7BH] hypothetical protein DXA46_08365 [Bacteroides sp. OF02-3LB] |
2.42e-11 | 79 | 60.000 | WP_117934011 |
MULTISPECIES: hypothetical protein [Bacteroides] |
3.34e-11 | 88 | 60.000 | WP_153882613 |
hypothetical protein M088_3555 [Bacteroides ovatus str. 3725 D1 iv] hypothetical protein M082_4022 [Bacteroides fragilis str. 3725 D9 ii] hypothetical protein M089_3843 [Bacteroides ovatus str. 3725 D9 iii] |
3.71e-11 | 86 | 65.306 | KDS12196 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein HMPREF9009_02989 [Bacteroides sp. 3_1_13] hypothetical protein DXA05_07790 [Bacteroides sp. AM54-2NS] hypothetical protein DWW25_03595 [Bacteroides xylanisolvens] hypothetical protein DW785_04595 [Bacteroides xylanisolvens] hypothetical protein EAJ13_05065 [Bacteroides xylanisolvens] |
5.07e-11 | 88 | 60.000 | WP_049702575 |
hypothetical protein Bache_0441 [Bacteroides helcogenes P 36-108] hypothetical protein HMPREF1204_03954 [Bacteroides fragilis HMW 615] hypothetical protein M116_3855 [Bacteroides fragilis str. 3719 A10] hypothetical protein M107_4014 [Bacteroides fragilis str. 3725 D9(v)] hypothetical protein MB0529_03538 [Bacteroides fragilis] |
5.64e-11 | 93 | 58.491 | ADV42467 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein B5F78_01210 [Bacteroides sp. An279] hypothetical protein B5F71_09600 [Bacteroides sp. An269] hypothetical protein B5F25_06975 [Bacteroides sp. An19] putative uncharacterized protein [Bacteroides sp. CAG:702] |
8.91e-11 | 84 | 62.500 | WP_022041137 |
hypothetical protein [Bacteroides sp. An51A] hypothetical protein B5G04_06215 [Bacteroides sp. An51A] |
9.01e-11 | 84 | 62.500 | WP_087396275 |
hypothetical protein [Fibrobacter succinogenes] hypothetical protein Fisuc_1583 [Fibrobacter succinogenes subsp. succinogenes S85] hypothetical protein FSU_2069 [Fibrobacter succinogenes subsp. succinogenes S85] |
5.24e-10 | 84 | 60.417 | WP_014546264 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein DXB58_02900 [Bacteroides sp. OM05-10AA] hypothetical protein DWY87_01890 [Bacteroides sp. AF27-33] |
5.28e-10 | 79 | 62.222 | WP_122135860 |
putative uncharacterized protein [Prevotella sp. CAG:732] |
1.09e-09 | 86 | 59.184 | CDD18962 |
hypothetical protein DXA63_15135 [Prevotella copri] |
1.12e-09 | 77 | 59.091 | RGX89367 |
hypothetical protein SAMN05444350_116135 [Bacteroides stercorirosoris] |
2.57e-09 | 79 | 60.000 | SHJ15041 |
conserved domain protein [Bacteroides ovatus SD CMC 3f] |
7.8e-09 | 61 | 80.000 | EFF49741 |
hypothetical protein BSCG_03311 [Bacteroides sp. 2_2_4] |
8.18e-09 | 61 | 80.000 | EEO56384 |
hypothetical protein [Bacteroides sp. AF26-7BH] hypothetical protein DWY71_08905 [Bacteroides sp. AF26-7BH] hypothetical protein DXA46_08085 [Bacteroides sp. OF02-3LB] |
2.18e-08 | 79 | 57.778 | WP_117933941 |
hypothetical protein Barb6XT_03233 [Bacteroidales bacterium Barb6XT] hypothetical protein Barb6XT_02229 [Bacteroidales bacterium Barb6XT] hypothetical protein Barb6_02344 [Bacteroidales bacterium Barb6] |
2.23e-08 | 82 | 53.191 | OAV63164 |
hypothetical protein [Fibrobacter sp. UWEL] hypothetical protein SAMN05720468_107131 [Fibrobacter sp. UWEL] |
8.6e-08 | 51 | 86.207 | WP_073227407 |
MULTISPECIES: hypothetical protein [unclassified Fibrobacter] hypothetical protein B7991_10690 [Fibrobacter sp. UWB3] hypothetical protein SAMN06298224_2673 [Fibrobacter sp. UWB16] |
1.02e-07 | 77 | 61.364 | WP_088630817 |
hypothetical protein [Fibrobacter succinogenes] hypothetical protein Fisuc_1964 [Fibrobacter succinogenes subsp. succinogenes S85] hypothetical protein FSU_2486 [Fibrobacter succinogenes subsp. succinogenes S85] |
1.53e-07 | 77 | 61.364 | WP_014546622 |
hypothetical protein SAMN05444350_12477 [Bacteroides stercorirosoris] |
3.53e-07 | 68 | 66.667 | SHJ36911 |
hypothetical protein [Fibrobacter sp. UWB7] hypothetical protein SAMN05720467_3135 [Fibrobacter sp. UWB7] |
3.57e-07 | 77 | 61.364 | WP_073443421 |
MULTISPECIES: hypothetical protein [unclassified Fibrobacter] hypothetical protein B7993_08370 [Fibrobacter sp. UWH3] hypothetical protein B7992_09710 [Fibrobacter sp. UWH1] hypothetical protein B0H52_1723 [Fibrobacter sp. UWH8] hypothetical protein SAMN05720766_109112 [Fibrobacter sp. UWH9] hypothetical protein SAMN05720765_112124 [Fibrobacter sp. UWH6] |
4.3e-07 | 88 | 52.000 | WP_073161277 |
hypothetical protein Barb6_01701 [Bacteroidales bacterium Barb6] |
9.73e-07 | 82 | 55.319 | OAV70541 |
hypothetical protein [Fibrobacter succinogenes] |
1.14e-06 | 84 | 54.167 | WP_041259984 |
MULTISPECIES: hypothetical protein [unclassified Fibrobacter] hypothetical protein SAMN05720467_1984 [Fibrobacter sp. UWB7] hypothetical protein SAMN05720489_3156 [Fibrobacter sp. UWB13] |
1.16e-06 | 84 | 54.167 | WP_073424661 |
hypothetical protein [Fibrobacter sp. UWB12] hypothetical protein SAMN05720759_101265 [Fibrobacter sp. UWB12] |
1.19e-06 | 84 | 54.167 | WP_072826938 |
hypothetical protein Fisuc_0342 [Fibrobacter succinogenes subsp. succinogenes S85] |
1.19e-06 | 84 | 54.167 | ACX73954 |
hypothetical protein [Fibrobacter succinogenes] |
1.2e-06 | 84 | 54.167 | WP_041259986 |
hypothetical protein Fisuc_0343 [Fibrobacter succinogenes subsp. succinogenes S85] |
1.23e-06 | 84 | 54.167 | ACX73955 |
hypothetical protein [Fibrobacter sp. UWB11] hypothetical protein SAMN05720758_1581 [Fibrobacter sp. UWB11] |
1.26e-06 | 84 | 54.167 | WP_074208777 |
hypothetical protein DXA68_08530 [Bacteroides stercorirosoris] |
1.46e-06 | 68 | 64.103 | RGX79158 |
hypothetical protein BGX17_3303 [Fibrobacter sp. UWT1] hypothetical protein BGX12_1707 [Fibrobacter sp. UWR4] hypothetical protein C8E88_10737 [Fibrobacter sp. UWR1] hypothetical protein SAMN05720766_101107 [Fibrobacter sp. UWH9] |
1.47e-06 | 86 | 53.061 | PKV26576 |
hypothetical protein HMPREF0999_03115 [Parabacteroides sp. D25] hypothetical protein M091_0731 [Parabacteroides distasonis str. 3776 D15 i] hypothetical protein M090_3203 [Parabacteroides distasonis str. 3776 Po2 i] hypothetical protein M092_0702 [Parabacteroides distasonis str. 3776 D15 iv] hypothetical protein BSDG_03058 [Parabacteroides sp. 2_1_7] Uncharacterised protein [Parabacteroides distasonis] |
1.51e-06 | 84 | 52.000 | EKN27069 |
conserved hypothetical protein [Fibrobacter succinogenes subsp. succinogenes S85] |
1.52e-06 | 77 | 59.091 | ADL24917 |
hypothetical protein [Bacteroides sp. An322] hypothetical protein B5F91_10280 [Bacteroides sp. An322] |
1.78e-06 | 44 | 92.000 | WP_087429004 |
hypothetical protein [Fibrobacter sp. UWR2] hypothetical protein B7994_09605 [Fibrobacter sp. UWR2] |
1.8e-06 | 84 | 54.167 | WP_088638241 |
hypothetical protein HMPREF0102_02053 [Bacteroides sp. 2_1_22] conserved domain protein [Bacteroides xylanisolvens SD CC 2a] conserved domain protein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein BN890_20130 [Bacteroides xylanisolvens SD CC 1b] |
1.81e-06 | 82 | 51.064 | EEZ04884 |
hypothetical protein BSAG_03365 [Bacteroides sp. D1] hypothetical protein HMPREF1074_03318 [Bacteroides xylanisolvens CL03T12C04] hypothetical protein HMPREF9009_02250 [Bacteroides sp. 3_1_13] hypothetical protein BN891_28560 [Bacteroides xylanisolvens SD CC 2a] |
1.81e-06 | 72 | 56.098 | EEO51653 |
hypothetical protein HMPREF0619_02383 [Parabacteroides sp. D13] |
1.92e-06 | 84 | 52.000 | EEU51168 |
hypothetical protein Barb6_03697 [Bacteroidales bacterium Barb6] |
2.75e-06 | 82 | 53.191 | OAV63512 |
hypothetical protein [Fibrobacter succinogenes] hypothetical protein Fisuc_2408 [Fibrobacter succinogenes subsp. succinogenes S85] hypothetical protein FSU_2967 [Fibrobacter succinogenes subsp. succinogenes S85] |
3.59e-06 | 84 | 54.167 | WP_014547031 |
hypothetical protein SAMN04488493_105108 [Prevotella ruminicola] hypothetical protein SAMN04488494_2649 [Prevotella ruminicola] |
3.74e-06 | 82 | 53.191 | SFC32253 |
hypothetical protein [Fibrobacter sp. UWH4] hypothetical protein SAMN05720762_102141 [Fibrobacter sp. UWH4] |
5.94e-06 | 77 | 65.909 | WP_072977492 |
hypothetical protein [Fibrobacter sp. UWB12] hypothetical protein SAMN05720759_102357 [Fibrobacter sp. UWB12] |
9.09e-06 | 77 | 59.091 | WP_072827511 |
hypothetical protein Barb4_02534 [Bacteroidales bacterium Barb4] |
9.19e-06 | 82 | 53.191 | OAV67262 |
hypothetical protein SAMN05720758_1107 [Fibrobacter sp. UWB11] |
1e-05 | 86 | 51.020 | SIO03407 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{translation on same strand (frameshift candidate)}
Candidate nov_psm6_34 In bact CP040530.1
Seq (len = 57 ):
MARPIKETPILFGEDARRFEARMKNPPKETPEKLEEIKRDYKYIMSIFKEETDGRNK
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|152737|1|3582883-3583069
Transkriptom
87.0% of gene length expressed over median expression of contig.
ŝ
7.305134594797968
unique PSMS
8
unique PSMS
8
Genomic Context
Candidate has annotation on SAME strand. Which has 8 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_35 In clostri CP040626.1
Seq (len = 113 ):
LKSLKADAEAFLDEEVVDAVISVPAYFNDAQRKATKHAAELAGLKVERLILLIYIGVIVISFNLLPIPLLDGGRLWIGLFQGVARREISQKVLVSMEMISYIAILIIIIFIVI
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|354769|-1|2690554-2690896
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
3.978397283971757
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_36 In blautia CP039126.1
Seq (len = 415 ):
MNASGKSVEDVEDSIVDEIASYTLKLKERDGKTESIVASQINMQYVDDGKIQELKDKQNPFLWFLSFAHQNDYDMSATTTYDKDMLYAAVDALDAFQEANITQPADAYLGDTDTGYEIVPEVMGNALDKDKVKEQILKAIDGGKTELDLEAEDCYLKPTVYSTDENLIKQRDQSNAYLGVTVTFDFSDRQEVVNKDVIKNWLTTDENGDVVLDEEKAKEFVVEMAKKYDTFGYPRQFVTSSGETITVSGGDYGWLIARNDTTAKLVEAIKSGQSQTMEPEYTYRGYVRDTNDIGNTYVEISLQAQHMWFYKDGQLLVSTDVVTGNHNQGWDTHTGIYGIMYKERNATLVGENYSSPVQYWMPFYANTGIHDADWRDSFGGSEYINNGSHGCVNTPPSNAEKIYNNIEKGVPVVVY
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|242735|-1|5722369-5723782
Transkriptom
96.0% of gene length expressed over median expression of contig.
ŝ
10.202732459169281
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
molecular chaperone HscC [Paenibacillus sp. MEC069]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
molecular chaperone HscC [Paenibacillus sp. MEC069] molecular chaperone HscC [Paenibacillus sp. MEC069] |
7.81e-19 | 44 | 90.000 | WP_134753881 |
Hsp70 family protein [Paenibacillus sp. NEAU-GSW1] Hsp70 family protein [Paenibacillus sp. NEAU-GSW1] |
1.8e-18 | 44 | 88.000 | WP_156278271 |
MULTISPECIES: molecular chaperone HscC [unclassified Bacillus] molecular chaperone HscC [Bacillus sp. 491mf] |
1.05e-17 | 44 | 84.000 | WP_035437826 |
chaperone protein HscC [Tepidibacillus sp. HK-1] |
1.19e-17 | 44 | 88.000 | GBF10750 |
Hsp70 family protein [Paenibacillus xylanexedens] |
1.27e-17 | 44 | 84.000 | WP_145051324 |
molecular chaperone HscC [Clostridium bornimense] Heat shock protein 70 [Clostridium bornimense] |
1.68e-17 | 44 | 84.000 | WP_044040639 |
molecular chaperone HscC [Clostridium cavendishii] molecular chaperone HscC [Clostridium cavendishii DSM 21758] |
2.45e-17 | 44 | 84.000 | WP_072993685 |
molecular chaperone HscC [Paenibacillus sp. FF9] |
3.32e-17 | 44 | 84.000 | WP_054957708 |
molecular chaperone HscC [Paenibacillus bouchesdurhonensis] |
3.45e-17 | 44 | 84.000 | WP_110929988 |
molecular chaperone [Clostridium sp. Maddingley MBC34-26] |
3.94e-17 | 44 | 80.000 | EKQ50964 |
molecular chaperone HscC [Paenibacillus fonticola] |
4.16e-17 | 44 | 84.000 | WP_019637230 |
molecular chaperone HscC [Bacillus badius] Chaperone protein DnaK [Bacillus badius] molecular chaperone HscC [Bacillus badius] |
6.37e-17 | 44 | 84.000 | WP_041113022 |
molecular chaperone HscC [Paenibacillus paeoniae] molecular chaperone HscC [Paenibacillus paeoniae] |
6.37e-17 | 44 | 84.000 | WP_116047367 |
molecular chaperone HscC [Bacillus badius] Chaperone protein DnaK [Bacillus badius] |
6.5e-17 | 44 | 84.000 | WP_041099386 |
Hsp70 family protein [Paenibacillus ihumii] |
7.31e-17 | 44 | 84.000 | WP_055106990 |
Hsp70 family protein [Teredinibacter sp. ISS155] Chaperone protein HscC [Teredinibacter sp. ISS155] |
8.45e-17 | 44 | 84.000 | WP_142596820 |
molecular chaperone HscC [Rhodoferax sp. TH121] molecular chaperone HscC [Rhodoferax sp. TH121] |
1.02e-16 | 44 | 80.000 | WP_094481520 |
molecular chaperone HscC [Risungbinella massiliensis] |
1.12e-16 | 44 | 80.000 | WP_044641201 |
molecular chaperone HscC [Paenibacillus lentus] molecular chaperone HscC [Paenibacillus lentus] |
1.15e-16 | 44 | 82.000 | WP_125081395 |
molecular chaperone HscC [Paenibacillus sp. 32352] |
1.19e-16 | 44 | 82.000 | WP_079909027 |
molecular chaperone HscC [Paenibacillus rhizosphaerae] |
1.25e-16 | 44 | 80.000 | OMF54649 |
Hsp70 family protein [Paenibacillus sp. Y412MC10] |
1.27e-16 | 44 | 80.000 | WP_145136194 |
Hsp70 family protein [Paenibacillus sp. Y412MC10] |
1.34e-16 | 44 | 80.000 | WP_145025398 |
molecular chaperone HscC [Paenibacillus sp. SSG-1] molecular chaperone HscC [Paenibacillus sp. SSG-1] |
1.38e-16 | 44 | 80.000 | WP_089545762 |
molecular chaperone HscC [Paenibacillus sp. AR247] molecular chaperone HscC [Paenibacillus sp. AR247] |
1.39e-16 | 44 | 80.000 | WP_105441814 |
Hsp70 family protein [Paenibacillus terrae] |
1.39e-16 | 44 | 80.000 | WP_145160252 |
Hsp70 family protein [Paenibacillus rhizosphaerae] |
1.43e-16 | 44 | 80.000 | WP_144025422 |
molecular chaperone HscC [Paenibacillus sp. VMFN-D1] molecular chaperone HscC [Paenibacillus sp. VMFN-D1] |
1.44e-16 | 44 | 80.000 | WP_116232206 |
molecular chaperone HscC [Thermoflavimicrobium sp. FBKL4.011] molecular chaperone HscC [Thermoflavimicrobium sp. FBKL4.011] |
1.58e-16 | 44 | 80.000 | WP_113659928 |
Hsp70 family protein [Clostridium sp. Marseille-P4344] |
1.64e-16 | 44 | 82.000 | WP_105176515 |
molecular chaperone HscC [Paenibacillus sp. 7516] molecular chaperone HscC [Paenibacillus sp. 7516] |
1.77e-16 | 44 | 82.000 | WP_095291446 |
molecular chaperone HscC [Brevibacillus brevis] |
1.79e-16 | 44 | 84.000 | WP_064199869 |
Hsp70 family protein [Clostridium botulinum] chaperone protein, Hsp70 family [Clostridium botulinum B str. Eklund 17B (NRP)] Chaperone protein DnaK [Clostridium botulinum B str. Eklund 17B (NRP)] |
1.82e-16 | 44 | 82.000 | WP_012425652 |
MULTISPECIES: molecular chaperone HscC [Paenibacillus] molecular chaperone HscC [Paenibacillus sp. 7523-1] |
1.82e-16 | 44 | 82.000 | WP_095359889 |
molecular chaperone HscC [Paenibacillus illinoisensis] Chaperone heat shock Hsp70 protein [Paenibacillus illinoisensis] |
1.86e-16 | 44 | 82.000 | WP_110758687 |
molecular chaperone HscC [Tepidibacter mesophilus] |
1.88e-16 | 44 | 82.000 | WP_099189607 |
Hsp70 family protein [Paenibacillus xylanilyticus] |
1.95e-16 | 44 | 82.000 | WP_153980110 |
Hsp70 family protein [Clostridium botulinum] 2-alkenal reductase [Clostridium botulinum] |
2.01e-16 | 44 | 82.000 | WP_035787409 |
Hsp70 family protein [Clostridium botulinum] carbohydrate kinase, FGGY family [Clostridium botulinum 202F] 2-alkenal reductase [Clostridium botulinum] 2-alkenal reductase [Clostridium botulinum] |
2.01e-16 | 44 | 82.000 | WP_035791462 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
2.24e-16 | 44 | 82.000 | WP_098040239 |
molecular chaperone HscC [Clostridium sp. CT4] molecular chaperone HscC [Clostridium sp. CT4] |
2.26e-16 | 44 | 82.000 | WP_128214144 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
2.26e-16 | 44 | 82.000 | WP_097970020 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
2.3e-16 | 44 | 82.000 | WP_097989582 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
2.37e-16 | 44 | 82.000 | WP_098166242 |
molecular chaperone HscC [Anaerocolumna jejuensis] molecular chaperone HscC [Anaerocolumna jejuensis DSM 15929] |
2.42e-16 | 44 | 84.000 | WP_073271536 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
2.47e-16 | 44 | 82.000 | WP_097833704 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
2.49e-16 | 44 | 82.000 | WP_097850328 |
molecular chaperone HscC [Paenibacillus gorillae] |
2.51e-16 | 44 | 82.000 | WP_042168693 |
2-alkenal reductase [Bacillus galactosidilyticus] |
2.57e-16 | 44 | 80.000 | KRG13753 |
molecular chaperone HscC [Bacillus badius] molecular chaperone HscC [Bacillus badius] molecular chaperone HscC [Bacillus badius] molecular chaperone HscC [Bacillus badius] molecular chaperone HscC [Bacillus badius] |
2.74e-16 | 44 | 84.000 | WP_063384262 |
Hsp70 family protein [Paenibacillus woosongensis] Hsp70 family protein [Paenibacillus woosongensis] |
2.85e-16 | 44 | 82.000 | WP_155611597 |
molecular chaperone HscC [Paenibacillus lactis] |
2.97e-16 | 44 | 82.000 | HAF98463 |
MULTISPECIES: molecular chaperone HscC [Paenibacillus] Heat shock protein 70 [Paenibacillus lactis 154] |
3.24e-16 | 44 | 82.000 | WP_007128880 |
Hsp70 family protein [Hungateiclostridium clariflavum] molecular chaperone HscC [Hungateiclostridium clariflavum] |
3.3e-16 | 44 | 78.000 | WP_027621795 |
molecular chaperone HscC [Domibacillus indicus] |
3.47e-16 | 44 | 82.000 | WP_046176177 |
Hsp70 family protein, partial [Alcanivorax sp. HI0083] |
3.64e-16 | 44 | 80.000 | WP_156496667 |
Hsp70 family protein [Hungateiclostridium clariflavum] molecular chaperone [Hungateiclostridium clariflavum DSM 19732] |
3.78e-16 | 44 | 78.000 | WP_014256001 |
molecular chaperone HscC [Clostridium cellulovorans] Heat shock protein 70 [Clostridium cellulovorans 743B] |
4.05e-16 | 44 | 80.000 | WP_010073455 |
molecular chaperone HscC [Bacillus koreensis] 2-alkenal reductase [Bacillus koreensis] |
4.09e-16 | 56 | 68.254 | WP_053403179 |
molecular chaperone HscC [Pelosinus fermentans] Heat shock protein 70 [Pelosinus fermentans JBW45] |
4.12e-16 | 44 | 80.000 | WP_007953166 |
molecular chaperone HscC [Bacillaceae bacterium SAOS 7] molecular chaperone HscC [Bacillaceae bacterium SAOS 7] |
5.06e-16 | 44 | 82.000 | WP_095479975 |
molecular chaperone HscC [Bacillus sp. PK3_68] molecular chaperone HscC [Bacillus sp. PK3_68] |
5.11e-16 | 44 | 82.000 | WP_120036584 |
molecular chaperone HscC [Rhizobiales bacterium] |
5.46e-16 | 44 | 82.000 | WP_112410506 |
molecular chaperone HscC [Rhizobiales bacterium] |
5.51e-16 | 44 | 82.000 | WP_113240357 |
molecular chaperone HscC [Rhizobium sp. NFR17] molecular chaperone HscC [Rhizobium sp. NFR17] |
5.51e-16 | 44 | 82.000 | WP_112339019 |
molecular chaperone HscC [Paenibacillus ihbetae] molecular chaperone HscC [Paenibacillus ihbetae] |
5.64e-16 | 44 | 84.000 | WP_077568529 |
molecular chaperone HscC [Paenibacillus sp. OK076] molecular chaperone HscC [Paenibacillus sp. OK076] |
5.91e-16 | 44 | 82.000 | WP_090903582 |
molecular chaperone HscC [Paenibacillus pabuli] |
5.91e-16 | 44 | 82.000 | WP_062329267 |
molecular chaperone HscC [Bacillus cereus] hypothetical protein IEE_05145 [Bacillus cereus BAG5X1-1] |
6.15e-16 | 44 | 80.000 | WP_002106984 |
molecular chaperone HscC [Paenibacillus sp. DCT19] |
6.21e-16 | 44 | 80.000 | WP_128103710 |
Hsp70 family protein [Paenibacillus xylanexedens] |
6.52e-16 | 44 | 80.000 | WP_145406916 |
molecular chaperone HscC [Bacillus fastidiosus] |
6.65e-16 | 44 | 82.000 | WP_066230728 |
Hsp70 family protein [Bacillus subtilis] |
6.91e-16 | 44 | 82.000 | WP_158323715 |
molecular chaperone HscC [Brevibacillus panacihumi] chaperone heat shock Hsp70 protein [Brevibacillus panacihumi W25] |
7.19e-16 | 44 | 82.000 | WP_023555012 |
molecular chaperone HscC [Bacillus sp. SRB_8] molecular chaperone HscC [Bacillus sp. SRB_8] |
7.33e-16 | 56 | 66.667 | WP_113710184 |
molecular chaperone HscC [Bacillus sp. MYb209] molecular chaperone HscC [Bacillus sp. MYb209] |
7.54e-16 | 56 | 66.667 | WP_105587810 |
molecular chaperone HscC [Paenibacillus sp. Root52] 2-alkenal reductase [Paenibacillus sp. Root52] |
7.61e-16 | 44 | 80.000 | WP_056693617 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
7.69e-16 | 44 | 80.000 | WP_098149441 |
molecular chaperone HscC [Bacillus mycoides] 2-alkenal reductase [Bacillus mycoides] 2-alkenal reductase [Bacillus mycoides] 2-alkenal reductase [Bacillus mycoides] |
7.69e-16 | 56 | 66.667 | WP_048517374 |
molecular chaperone HscC [Bacillus pseudomycoides] Chaperone protein, Hsp70 [Bacillus pseudomycoides DSM 12442] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
7.77e-16 | 44 | 80.000 | WP_006097737 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
7.84e-16 | 44 | 80.000 | WP_098136528 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
7.84e-16 | 44 | 80.000 | WP_098188223 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
7.84e-16 | 44 | 80.000 | WP_098788308 |
molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] |
7.84e-16 | 44 | 80.000 | WP_098489109 |
molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
7.92e-16 | 44 | 80.000 | WP_098173580 |
molecular chaperone HscC [Bacillus mycoides] Chaperone protein, Hsp70 [Bacillus mycoides DSM 2048] mreB/Mbl family protein [Bacillus mycoides] hypothetical protein M2E15_2782 [Bacillus mycoides] Chaperone protein HscC [Bacillus mycoides] Chaperone protein HscC [Bacillus mycoides] |
7.92e-16 | 56 | 66.667 | WP_003193351 |
molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] |
7.92e-16 | 44 | 80.000 | WP_098478656 |
molecular chaperone HscC [Bacillus cereus] hypothetical protein IKQ_05481 [Bacillus cereus VDM053] |
8e-16 | 44 | 80.000 | WP_016130727 |
MULTISPECIES: molecular chaperone HscC [Bacillus cereus group] hypothetical protein IIW_01980 [Bacillus cereus VD136] hypothetical protein KOW_03646 [Bacillus cereus VDM006] hypothetical protein BTH41_01829 [Bacillus mycoides] molecular chaperone HscC [Bacillus pseudomycoides] molecular chaperone HscC [Bacillus pseudomycoides] |
8e-16 | 44 | 80.000 | WP_016115397 |
molecular chaperone HscC [Bacillus cereus] hypothetical protein ICG_05329 [Bacillus cereus BAG1X1-3] hypothetical protein IC7_05228 [Bacillus cereus BAG1O-1] molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] |
8e-16 | 44 | 80.000 | WP_000256284 |
molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] |
8.08e-16 | 44 | 80.000 | WP_098800945 |
MULTISPECIES: molecular chaperone HscC [Bacillus] molecular chaperone HscC [Bacillus sp. 112mf] |
8.08e-16 | 44 | 80.000 | WP_090814423 |
molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] |
8.08e-16 | 44 | 80.000 | WP_098888017 |
MULTISPECIES: molecular chaperone HscC [Bacillus cereus group] hypothetical protein KOY_02874 [Bacillus cereus VDM021] molecular chaperone HscC [Bacillus pseudomycoides] |
8.08e-16 | 44 | 80.000 | WP_016133080 |
molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] |
8.16e-16 | 44 | 80.000 | WP_098772359 |
molecular chaperone HscC [Bacillus mycoides] hypothetical protein S3E15_01796 [Bacillus mycoides] |
8.16e-16 | 44 | 80.000 | WP_087963094 |
molecular chaperone HscC [Clostridium amazonitimonense] |
8.23e-16 | 44 | 78.000 | WP_032122170 |
MULTISPECIES: molecular chaperone HscC [Bacillus] hypothetical protein IKO_05484 [Bacillus cereus VDM034] hypothetical protein IKS_05368 [Bacillus cereus VDM062] molecular chaperone HscC [Bacillus sp. MYb56] |
8.23e-16 | 56 | 66.667 | WP_002191619 |
molecular chaperone HscC [Paenibacillus xylaniclasticus] |
8.23e-16 | 44 | 80.000 | WP_127570608 |
molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] molecular chaperone HscC [Bacillus cereus] |
8.23e-16 | 44 | 80.000 | WP_097884084 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_37 In blautia CP039126.1
Seq (len = 355 ):
MNDNSSKETNLPVGSVAYGREIDAASLKKGDKIIYTNNNKAYVYKVTDMDSSAGSYKVKSVYDKNAKEETVQLINNAVKVVVVVPYIAYAAIALQSKEGLIVVGLGVIFLIILFILAELWRKDEADDDEEEDEEEEDASDEDDSEEDEDEDEEEEKLSRKERKRLKKEEKRRRKLAKKGLSDEEEAEDDEAEAPVLEPAPAPAKQPDEYDSAMKDAMASIAESIAKVQNGEIEAPEEVQETAVPQVTAEIILGLEENADSEEPAAEIISDDTAIQETADEEAVQPQEEMAAEEEVQQEEEIEPEPEEVPVVDKEAVLPAPSVTELLSKAEAAGESPEVIEDKDNEVTLLDYSKLL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|267399|-1|5098784-5099981
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
8.46979141956206
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
L,D-transpeptidase family protein [Clostridiales bacterium VE202-06]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
L,D-transpeptidase family protein [Clostridiales bacterium VE202-06] |
0.0 | 100 | 100.000 | WP_044954408 |
hypothetical protein PMF13cell1_00181 [Blautia producta] |
0.0 | 100 | 100.000 | QBE94688 |
L,D-transpeptidase family protein [Blautia coccoides] putative peptidoglycan binding protein [Blautia coccoides] ErfK family protein [Blautia coccoides] |
0.0 | 100 | 100.000 | WP_115624255 |
MULTISPECIES: L,D-transpeptidase family protein [Blautia] hypothetical protein C3R19_03715 [Blautia producta] hypothetical protein DXA40_10670 [Blautia sp. OF01-4LB] hypothetical protein DWV84_23575 [Blautia sp. AF13-16] |
0.0 | 100 | 98.313 | WP_033139810 |
L,D-transpeptidase family protein [Blautia marasmi] |
0.0 | 100 | 96.867 | WP_104803884 |
MULTISPECIES: L,D-transpeptidase family protein [Blautia] hypothetical protein A4V09_17365 [Blautia sp. YL58] hypothetical protein ADH70_015910 [Blautia coccoides] |
0.0 | 100 | 96.386 | WP_065543485 |
MULTISPECIES: L,D-transpeptidase family protein [Blautia] |
0.0 | 100 | 96.145 | WP_095174827 |
L,D-transpeptidase family protein [Lachnospiraceae bacterium 6_1_63FAA] hypothetical protein HMPREF0992_02246 [Lachnospiraceae bacterium 6_1_63FAA] |
0.0 | 100 | 69.639 | WP_009247488 |
L,D-transpeptidase family protein [Blautia hansenii] hypothetical protein CGC63_01715 [Blautia hansenii DSM 20583] ErfK/YbiS/YcfS/YnhG [Blautia hansenii DSM 20583] |
0.0 | 100 | 69.398 | WP_004221546 |
MULTISPECIES: L,D-transpeptidase family protein [unclassified Firmicutes sensu stricto (miscellaneous)] hypothetical protein DXB47_11880 [Firmicutes bacterium OM04-13BH] |
0.0 | 100 | 70.361 | WP_118701388 |
putative uncharacterized protein [Lachnospiraceae bacterium CAG:364] |
0.0 | 100 | 69.639 | CDC07751 |
L,D-transpeptidase family protein [Blautia hansenii] |
0.0 | 100 | 69.398 | WP_156342033 |
putative uncharacterized protein [Firmicutes bacterium CAG:227] |
0.0 | 100 | 70.120 | CDC94373 |
L,D-transpeptidase family protein [Firmicutes bacterium AM10-47] hypothetical protein DW128_09070 [Firmicutes bacterium AM10-47] |
0.0 | 100 | 70.120 | WP_117456949 |
MULTISPECIES: L,D-transpeptidase family protein [unclassified Lachnospiraceae] hypothetical protein DW675_05680 [Lachnospiraceae bacterium AM25-22] hypothetical protein DW664_05690 [Lachnospiraceae bacterium AM25-11LB] hypothetical protein DW685_05655 [Lachnospiraceae bacterium AM25-40] hypothetical protein DW684_04450 [Lachnospiraceae bacterium AM25-39] |
0.0 | 100 | 69.639 | WP_117467763 |
L,D-transpeptidase family protein [Blautia sp. Marseille-P3201T] |
0.0 | 100 | 69.398 | WP_072447550 |
L,D-transpeptidase family protein [Blautia sp. N6H1-15] hypothetical protein DQQ01_01935 [Blautia sp. N6H1-15] |
0.0 | 100 | 68.916 | WP_111920798 |
L,D-transpeptidase family protein [Blautia sp. An81] hypothetical protein B5G33_12295 [Blautia sp. An81] |
0.0 | 100 | 68.675 | WP_087417847 |
L,D-transpeptidase family protein [Blautia sp. An46] hypothetical protein B5G00_10415 [Blautia sp. An46] |
0.0 | 100 | 68.675 | WP_087272517 |
putative uncharacterized protein [Firmicutes bacterium CAG:424] |
0.0 | 100 | 65.542 | CDC44004 |
L,D-transpeptidase family protein [Firmicutes bacterium] |
0.0 | 100 | 65.542 | WP_147577441 |
MULTISPECIES: L,D-transpeptidase family protein [unclassified Lactonifactor] L,D-transpeptidase family protein [Lactonifactor sp. BIOML-A5] L,D-transpeptidase family protein [Lactonifactor sp. BIOML-A4] L,D-transpeptidase family protein [Lactonifactor sp. BIOML-A3] L,D-transpeptidase family protein [Lactonifactor sp. BIOML-A2] L,D-transpeptidase family protein [Lactonifactor sp. BIOML-A1] |
1.93e-179 | 100 | 60.337 | WP_154256980 |
L,D-transpeptidase family protein, partial [Lactonifactor longoviformis] hypothetical protein C3B58_09065, partial [Lactonifactor longoviformis] |
4.82e-179 | 100 | 60.337 | WP_103710936 |
L,D-transpeptidase family protein [Lactonifactor longoviformis] Putative peptidoglycan binding domain-containing protein [Lactonifactor longoviformis DSM 17459] |
5.93e-179 | 100 | 60.337 | WP_072854390 |
putative peptidoglycan binding domain, partial [uncultured bacterium] |
1.02e-177 | 77 | 72.586 | APO27921 |
L,D-transpeptidase family protein [Blautia hydrogenotrophica] ErfK/YbiS/YcfS/YnhG [Blautia hydrogenotrophica DSM 10507] |
3.14e-144 | 100 | 49.157 | WP_005952403 |
L,D-transpeptidase family protein [Blautia hydrogenotrophica] putative uncharacterized protein [Blautia hydrogenotrophica CAG:147] Uncharacterized vancomycin resistance protein [Blautia hydrogenotrophica] Uncharacterized vancomycin resistance protein [uncultured Blautia sp.] |
6.31e-144 | 100 | 49.157 | WP_021845304 |
L,D-transpeptidase family protein [Ruminococcus gauvreauii] |
9.61e-143 | 100 | 48.804 | WP_028527644 |
L,D-transpeptidase family protein [Blautia sp. AF22-5LB] hypothetical protein DWX98_06740 [Blautia sp. AF22-5LB] |
1.41e-142 | 100 | 49.400 | WP_118575470 |
L,D-transpeptidase family protein [Lachnospiraceae bacterium BSM-380-WT-5A] L,D-transpeptidase family protein [Lachnospiraceae bacterium BSM-380-WT-5A] |
5.73e-142 | 100 | 49.161 | WP_154432789 |
MULTISPECIES: L,D-transpeptidase family protein [Clostridium] peptidoglycan-binding protein [Clostridium beijerinckii] peptidoglycan-binding protein [Clostridium sp. 2-1] |
2.62e-140 | 100 | 47.470 | WP_078114666 |
L,D-transpeptidase family protein [Clostridium beijerinckii] hypothetical protein CLOBE_14130 [Clostridium beijerinckii] |
4.92e-140 | 100 | 47.470 | WP_077854664 |
L,D-transpeptidase family protein [Clostridium beijerinckii] |
1.32e-139 | 100 | 47.470 | WP_017209085 |
MULTISPECIES: L,D-transpeptidase family protein [Clostridium] peptidoglycan-binding protein [Clostridium sp. MF28] peptidoglycan-binding protein [Clostridium diolis] |
5.95e-139 | 100 | 47.229 | WP_105411427 |
MULTISPECIES: L,D-transpeptidase family protein [Clostridium] secreted protein containing uncharacterized conserved protein of ErfK family [Clostridium beijerinckii NCIMB 8052] ErfK family protein [Clostridium beijerinckii ATCC 35702] hypothetical protein CLOSB_06760 [Clostridium beijerinckii] hypothetical protein CLBKI_06930 [Clostridium beijerinckii] peptidoglycan-binding protein [Clostridium diolis] |
6.85e-139 | 100 | 47.229 | WP_012060263 |
L,D-transpeptidase family protein [Clostridium beijerinckii] hypothetical protein CBEIJ_13060 [Clostridium beijerinckii] |
6.93e-139 | 100 | 47.229 | WP_077829420 |
unnamed protein product peptidoglycan-binding protein [Clostridium beijerinckii NRRL B-598] |
7.4e-139 | 100 | 47.229 | WP_023973099 |
putative peptidoglycan binding domain [uncultured bacterium] |
8.34e-139 | 98 | 50.123 | APO28368 |
L,D-transpeptidase family protein [Blautia sp. An249] hypothetical protein B5F53_14965 [Blautia sp. An249] |
1.47e-138 | 98 | 49.877 | WP_087224935 |
L,D-transpeptidase family protein [Clostridium beijerinckii] hypothetical protein CLBIJ_43850 [Clostridium beijerinckii] peptidoglycan-binding protein [Clostridium beijerinckii] hypothetical protein CLBEJ_20030 [Clostridium beijerinckii] hypothetical protein CLOBJ_01550 [Clostridium beijerinckii] |
1.91e-138 | 100 | 46.988 | WP_065418744 |
L,D-transpeptidase family protein [Clostridium diolis] L,D-transpeptidase family protein [Clostridium diolis] hypothetical protein CDIOL_00290 [Clostridium diolis] |
3.74e-138 | 100 | 46.988 | WP_039771585 |
L,D-transpeptidase family protein [Clostridium beijerinckii] hypothetical protein CLBEI_28610 [Clostridium beijerinckii] hypothetical protein CBE01nite_03980 [Clostridium beijerinckii] ErfK family protein [Clostridium beijerinckii] |
4.04e-138 | 100 | 46.988 | WP_077868916 |
L,D-transpeptidase family protein [Clostridium beijerinckii] hypothetical protein CLOBI_27800 [Clostridium beijerinckii] hypothetical protein CLBEIC_39790 [Clostridium beijerinckii] conserved protein of unknown function [Clostridium beijerinckii] |
9.86e-138 | 100 | 46.988 | WP_077843274 |
L,D-transpeptidase family protein [Clostridium beijerinckii] peptidoglycan-binding protein [Clostridium beijerinckii] |
9.49e-137 | 100 | 46.988 | WP_041899224 |
L,D-transpeptidase family protein [Clostridium beijerinckii] hypothetical protein CLBCK_05680 [Clostridium beijerinckii] |
3.78e-136 | 100 | 46.747 | WP_077837398 |
L,D-transpeptidase family protein [Blautia sp. KGMB01111] hypothetical protein ETP43_03190 [Blautia sp. KGMB01111] |
5.59e-136 | 100 | 50.120 | WP_129257012 |
putative uncharacterized protein [Roseburia sp. CAG:471] |
1.1e-135 | 100 | 50.120 | CDD99053 |
putative peptidoglycan binding domain, partial [uncultured bacterium] |
1.32e-135 | 61 | 72.835 | APO28266 |
L,D-transpeptidase family protein [Blautia sp. AF19-34] hypothetical protein DWX49_13060 [Blautia sp. AF19-34] |
1.41e-135 | 100 | 49.400 | WP_118618843 |
MULTISPECIES: L,D-transpeptidase family protein [Robinsoniella] putative vancomycin resistance protein [Robinsoniella peoriensis] |
2.68e-135 | 100 | 47.722 | WP_027296889 |
L,D-transpeptidase family protein [Robinsoniella peoriensis] |
3.22e-135 | 100 | 47.722 | WP_044296626 |
Uncharacterized vancomycin resistance protein [uncultured Blautia sp.] |
6.19e-135 | 100 | 49.640 | SCJ27224 |
L,D-transpeptidase family protein [Blautia sp. SG-772] hypothetical protein C6W64_005330 [Blautia sp. SG-772] |
6.76e-135 | 100 | 49.400 | WP_106492870 |
hypothetical protein RHS_1891 [Robinsoniella sp. RHS] |
7.21e-135 | 100 | 47.722 | KLU72264 |
L,D-transpeptidase family protein [Clostridium beijerinckii] |
2.75e-134 | 100 | 46.024 | WP_026888486 |
putative uncharacterized protein [Blautia sp. CAG:52] |
3.65e-134 | 100 | 49.161 | CDB19685 |
MULTISPECIES: L,D-transpeptidase family protein [unclassified Blautia] hypothetical protein DW177_11715 [Blautia sp. AM16-16B] hypothetical protein DW266_15285 [Blautia sp. AM22-22LB] hypothetical protein DWY34_07850 [Blautia sp. AF25-12LB] hypothetical protein DW962_09200 [Blautia sp. AM46-5] hypothetical protein DW961_11880 [Blautia sp. AM46-3MH] |
2.01e-133 | 100 | 48.921 | WP_117525419 |
L,D-transpeptidase family protein [Clostridium carboxidivorans] ErfK/YbiS/YcfS/YnhG family protein [Clostridium carboxidivorans P7] hypothetical protein CLCAR_1082 [Clostridium carboxidivorans P7] |
6.88e-132 | 100 | 45.783 | WP_007060531 |
peptidoglycan-binding protein [Clostridium carboxidivorans P7] |
9.88e-132 | 100 | 45.783 | AKN34231 |
Uncharacterized vancomycin resistance protein [uncultured Clostridium sp.] |
2.36e-131 | 99 | 46.135 | SCG88279 |
L,D-transpeptidase family protein [Blautia schinkii] |
2.9e-131 | 100 | 47.596 | WP_044945710 |
L,D-transpeptidase family protein [Blautia sp. OF03-15BH] hypothetical protein DXA57_14540 [Blautia sp. OF03-15BH] |
5.88e-131 | 99 | 45.894 | WP_117768004 |
hypothetical protein [Lachnospiraceae bacterium] |
2.21e-130 | 100 | 45.803 | HAU84521 |
MULTISPECIES: L,D-transpeptidase family protein [Clostridiales] hypothetical protein DXA96_08075 [Lachnospiraceae bacterium OF09-33XD] |
1.53e-129 | 100 | 46.763 | WP_118644843 |
L,D-transpeptidase family protein [Clostridium autoethanogenum] ErfK/YbiS/YcfS/YnhG family protein [Clostridium autoethanogenum DSM 10061] Peptidoglycan binding domain-containing protein YkuD family protein [Clostridium autoethanogenum DSM 10061] hypothetical protein WX72_01943 [Clostridium autoethanogenum] peptidoglycan-binding protein [Clostridium autoethanogenum] |
2.12e-129 | 100 | 46.024 | WP_023163323 |
L,D-transpeptidase family protein [Clostridium ljungdahlii] conserved hypothetical protein [Clostridium ljungdahlii DSM 13528] hypothetical protein WX45_00079 [Clostridium ljungdahlii DSM 13528] |
2.39e-129 | 100 | 46.024 | WP_013238234 |
L,D-transpeptidase family protein [Ruminococcus gauvreauii] |
2.46e-129 | 100 | 47.156 | WP_044983100 |
hypothetical protein [Lachnospiraceae bacterium] |
7.7e-129 | 100 | 49.289 | HCT92904 |
L,D-transpeptidase family protein [Clostridium coskatii] hypothetical protein WX73_00508 [Clostridium coskatii] hypothetical protein CLCOS_12140 [Clostridium coskatii] |
1.57e-128 | 100 | 45.783 | WP_153042911 |
L,D-transpeptidase family protein [Clostridium pasteurianum] ErfK/YbiS/YcfS/YnhG family protein [Clostridium pasteurianum DSM 525 = ATCC 6013] ErfK/YbiS/YcfS/YnhG family protein [Clostridium pasteurianum DSM 525 = ATCC 6013] peptidoglycan-binding protein [Clostridium pasteurianum DSM 525 = ATCC 6013] peptidoglycan-binding protein [Clostridium pasteurianum] hypothetical protein F502_05137 [Clostridium pasteurianum DSM 525 = ATCC 6013] |
2.92e-128 | 100 | 45.783 | WP_003442512 |
L,D-transpeptidase family protein [[Clostridium] polysaccharolyticum] Putative peptidoglycan binding domain-containing protein [[Clostridium] polysaccharolyticum] |
5.77e-128 | 100 | 45.324 | WP_092477655 |
L,D-transpeptidase family protein [Clostridium autoethanogenum] |
6.16e-128 | 100 | 45.783 | WP_029702398 |
L,D-transpeptidase family protein [Clostridium kluyveri] Conserved hypothetical protein [Clostridium kluyveri DSM 555] hypothetical protein CKR_0474 [Clostridium kluyveri NBRC 12016] |
9.2e-128 | 99 | 45.763 | WP_011989106 |
hypothetical protein RHS_2986 [Robinsoniella sp. RHS] |
2.12e-127 | 100 | 43.855 | KLU71207 |
putative vancomycin resistance protein [Robinsoniella peoriensis] |
2.33e-127 | 100 | 43.855 | TLD00500 |
MULTISPECIES: L,D-transpeptidase family protein [Robinsoniella] |
2.37e-127 | 100 | 43.855 | WP_152614178 |
L,D-transpeptidase family protein [Robinsoniella peoriensis] |
2.4e-127 | 100 | 43.855 | WP_138002586 |
hypothetical protein B2M23_07015 [Eubacterium limosum] |
2.49e-127 | 100 | 45.301 | ARD67920 |
L,D-transpeptidase family protein [Robinsoniella peoriensis] |
2.77e-127 | 100 | 43.855 | WP_083267318 |
MULTISPECIES: L,D-transpeptidase family protein [Clostridiales] hypothetical protein ELI_3916 [Eubacterium callanderi] hypothetical protein BUME_31090 [[Butyribacterium] methylotrophicum] |
3.21e-127 | 100 | 46.024 | WP_013382167 |
L,D-transpeptidase family protein [Eubacterium limosum] peptidoglycan-binding domain-containing protein [Eubacterium limosum] |
3.21e-127 | 100 | 46.024 | WP_058693492 |
L,D-transpeptidase family protein [Eubacterium limosum] Putative peptidoglycan binding domain-containing protein [Eubacterium limosum] |
3.47e-127 | 100 | 46.024 | WP_083337116 |
MULTISPECIES: L,D-transpeptidase family protein [Eubacterium] peptidoglycan-binding protein [Eubacterium sp. AM05-23] |
3.7e-127 | 100 | 46.024 | WP_118517261 |
L,D-transpeptidase family protein [Clostridium sp. AWRP] peptidoglycan-binding protein [Clostridium sp. AWRP] |
3.82e-127 | 100 | 45.060 | WP_127720791 |
peptidoglycan-binding protein [Clostridium kluyveri] |
4.47e-127 | 99 | 45.411 | APM37876 |
L,D-transpeptidase family protein [Clostridioides difficile] hypothetical protein CDFC105_63201 [Clostridioides difficile] hypothetical protein CDFC105_73681 [Clostridioides difficile] |
5.78e-127 | 100 | 45.585 | WP_074179834 |
L,D-transpeptidase family protein [Clostridioides difficile] hypothetical protein IM33_16165 [Clostridioides difficile] |
5.91e-127 | 100 | 45.585 | WP_054274876 |
L,D-transpeptidase family protein [Clostridium ljungdahlii] hypothetical protein WY13_01187 [Clostridium ljungdahlii] |
9.74e-127 | 100 | 45.301 | WP_156498973 |
Putative peptidoglycan binding domain-containing protein [Eubacterium callanderi] |
1.55e-126 | 100 | 46.024 | SHM39514 |
L,D-transpeptidase family protein [Murimonas intestini] |
1.64e-126 | 100 | 45.192 | WP_148410607 |
UNVERIFIED_CONTAM: peptidoglycan transpeptidase precursor (ErfK-YbiS-YhnG family) [Murimonas intestini] |
1.85e-126 | 100 | 45.192 | PWJ75479 |
Uncharacterized vancomycin resistance protein [[Ruminococcus] torques] Uncharacterized vancomycin resistance protein [uncultured Blautia sp.] Uncharacterized vancomycin resistance protein [uncultured Ruminococcus sp.] |
2.02e-126 | 100 | 45.192 | CUQ57948 |
L,D-transpeptidase family protein [Eubacterium maltosivorans] peptidoglycan-binding protein [Eubacterium maltosivorans] |
2.05e-126 | 100 | 45.783 | WP_096918690 |
ErfK/YbiS/YcfS/YnhG family protein [Clostridium scatologenes] |
2.66e-126 | 100 | 45.060 | AKA70919 |
L,D-transpeptidase family protein [Clostridium scatologenes] |
3.49e-126 | 100 | 45.060 | WP_046066026 |
MULTISPECIES: L,D-transpeptidase family protein [Eubacterium] L,D-transpeptidase family protein [Eubacterium sp. BL-380-WT-2B] |
3.8e-126 | 100 | 46.024 | WP_143163953 |
L,D-transpeptidase family protein [Eubacterium callanderi] peptidoglycan transpeptidase precursor, ErfK-YbiS-YhnG family [Eubacterium callanderi] |
3.97e-126 | 100 | 46.024 | WP_090414962 |
L,D-transpeptidase family protein [Ruminococcaceae bacterium] |
4.92e-126 | 100 | 45.192 | WP_148461003 |
L,D-transpeptidase family protein [Clostridioides difficile] |
6.89e-126 | 100 | 45.107 | WP_054271490 |
peptidoglycan-binding protein [Clostridioides difficile] |
8.75e-126 | 100 | 45.107 | KPI47477 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_38 In blautia CP039126.1
Seq (len = 77 ):
MKDELEAKRAEGMIQGRAQGKAEGILALLNDLGQVPESLQVKIMAQKNTEVLNQWLKYAAKAETINDFVQKTNSQRS
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|205416|1|5750376-5751306
Transkriptom
43.0% of gene length expressed over median expression of contig.
ŝ
6.798876102792621
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
primosomal protein [Blautia producta] hypothetical protein PMF13cell1_01948 [Blautia producta] processing peptidase [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
0.0 | 100 | 100.000 | WP_018597886 |
MULTISPECIES: hypothetical protein [Blautia] |
6.57e-159 | 100 | 83.520 | WP_095172205 |
hypothetical protein [Blautia marasmi] |
2.49e-158 | 100 | 83.240 | WP_104804157 |
MULTISPECIES: hypothetical protein [Blautia] hypothetical protein A4V09_15610 [Blautia sp. YL58] hypothetical protein ADH70_014130 [Blautia coccoides] |
1.06e-155 | 100 | 82.682 | WP_065543193 |
hypothetical protein [Blautia producta] |
3.49e-155 | 100 | 84.916 | WP_033143887 |
hypothetical protein [Blautia producta] |
3.49e-155 | 100 | 85.196 | WP_148392896 |
MULTISPECIES: hypothetical protein [Blautia] hypothetical protein C3R19_12740 [Blautia producta] hypothetical protein DXA40_01855 [Blautia sp. OF01-4LB] hypothetical protein DWV84_01185 [Blautia sp. AF13-16] |
1.4e-154 | 100 | 84.637 | WP_103731987 |
putative uncharacterized protein [Firmicutes bacterium CAG:227] |
4.17e-63 | 100 | 42.857 | CDC91737 |
MULTISPECIES: hypothetical protein [unclassified Firmicutes sensu stricto (miscellaneous)] hypothetical protein DW128_11490 [Firmicutes bacterium AM10-47] hypothetical protein DXB47_08110 [Firmicutes bacterium OM04-13BH] |
3.2e-61 | 100 | 43.536 | WP_117457293 |
hypothetical protein [Lachnospiraceae bacterium 6_1_63FAA] hypothetical protein HMPREF0992_00734 [Lachnospiraceae bacterium 6_1_63FAA] |
1.68e-56 | 100 | 45.431 | WP_009246524 |
hypothetical protein [Lactonifactor longoviformis] hypothetical protein SAMN02745158_00838 [Lactonifactor longoviformis DSM 17459] |
2.59e-55 | 100 | 39.444 | WP_072849245 |
hypothetical protein [Blautia hansenii] |
3.94e-54 | 100 | 44.072 | WP_156342146 |
hypothetical protein [Blautia hansenii] hypothetical protein CGC63_12845 [Blautia hansenii DSM 20583] hypothetical protein BLAHAN_06383 [Blautia hansenii DSM 20583] |
4.87e-54 | 100 | 43.782 | WP_003022822 |
MULTISPECIES: hypothetical protein [unclassified Lactonifactor] hypothetical protein [Lactonifactor sp. BIOML-A5] hypothetical protein [Lactonifactor sp. BIOML-A4] hypothetical protein [Lactonifactor sp. BIOML-A3] hypothetical protein [Lactonifactor sp. BIOML-A2] hypothetical protein [Lactonifactor sp. BIOML-A1] |
3.31e-51 | 100 | 40.443 | WP_154257234 |
hypothetical protein [Blautia sp. An81] hypothetical protein B5G33_07340 [Blautia sp. An81] |
7.59e-46 | 35 | 59.350 | WP_158229585 |
hypothetical protein B5G00_08845 [Blautia sp. An46] |
7.76e-46 | 35 | 59.350 | OUN92475 |
putative uncharacterized protein [Lachnospiraceae bacterium CAG:364] |
3.53e-43 | 64 | 49.367 | CDC08324 |
hypothetical protein [Ruminococcus sp. AF25-28AC] hypothetical protein DWY50_04835 [Ruminococcus sp. AF25-28AC] |
9.27e-35 | 100 | 30.220 | WP_118520919 |
hypothetical protein C3B58_17045, partial [Lactonifactor longoviformis] |
2.51e-34 | 34 | 51.639 | POP31312 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein DW987_05850 [Ruminococcus sp. AM50-15BH] hypothetical protein DW955_13265 [Ruminococcus sp. AM45-9BH] hypothetical protein DW953_12840 [Ruminococcus sp. AM45-2] Uncharacterised protein [Blautia wexlerae] |
6.76e-34 | 100 | 29.945 | WP_055150446 |
hypothetical protein [Ruminococcus sp. AM34-9LB] hypothetical protein DW836_05705 [Ruminococcus sp. AM34-9LB] |
7.12e-34 | 100 | 29.945 | WP_118569106 |
hypothetical protein [Ruminococcus sp. TM09-4] hypothetical protein DXD85_04305 [Ruminococcus sp. TM09-4] |
1.26e-33 | 100 | 29.945 | WP_118616696 |
hypothetical protein [Ruminococcus sp. AM44-9AT] hypothetical protein DW952_18880 [Ruminococcus sp. AM44-9AT] |
4.61e-33 | 100 | 29.670 | WP_128866856 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein BHW51_09000 [Ruminococcus sp. CAG:9-related_41_34] putative uncharacterized protein [Ruminococcus sp. CAG:9] hypothetical protein RSAG_02842 [Ruminococcus sp. 5_1_39BFAA] hypothetical protein DW225_11555 [Ruminococcus sp. AM18-44] hypothetical protein DW217_11215 [Ruminococcus sp. AM18-15] |
5.01e-33 | 100 | 29.670 | WP_008707244 |
hypothetical protein [Blautia obeum] Uncharacterised protein [Blautia obeum] |
5.16e-33 | 100 | 29.670 | WP_055057336 |
hypothetical protein [Ruminococcus sp. AF14-5] hypothetical protein DWW20_05975 [Ruminococcus sp. AF14-5] |
5.44e-33 | 100 | 29.670 | WP_118610635 |
hypothetical protein [Ruminococcaceae bacterium] |
5.53e-33 | 99 | 31.831 | WP_019162502 |
hypothetical protein [Ruminococcus sp. AM32-17LB] hypothetical protein DW805_00180 [Ruminococcus sp. AM32-17LB] |
7.96e-33 | 100 | 29.444 | WP_118585256 |
hypothetical protein [Blautia sp. Marseille-P2398] |
8.04e-33 | 100 | 29.670 | WP_062807930 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein DW711_07505 [Ruminococcus sp. AM27-16] hypothetical protein DXB17_08905 [Ruminococcus sp. OM02-16LB] Uncharacterised protein [Blautia wexlerae] |
8.3e-33 | 100 | 29.670 | WP_055200164 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein DWZ49_06395 [Ruminococcus sp. AF33-11BH] hypothetical protein DW903_05525 [Ruminococcus sp. AM42-10AC] Uncharacterised protein [Blautia obeum] |
8.83e-33 | 100 | 29.396 | WP_055052567 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] hypothetical protein DW675_02700 [Lachnospiraceae bacterium AM25-22] hypothetical protein DW664_02690 [Lachnospiraceae bacterium AM25-11LB] hypothetical protein DW685_02685 [Lachnospiraceae bacterium AM25-40] hypothetical protein DW684_03750 [Lachnospiraceae bacterium AM25-39] |
1.15e-32 | 29 | 58.654 | WP_117467176 |
MULTISPECIES: hypothetical protein [unclassified Ruminococcus] hypothetical protein DXD97_05340 [Ruminococcus sp. TM10-9AT] hypothetical protein DW253_06050 [Ruminococcus sp. AM22-13] hypothetical protein DWY28_04635 [Ruminococcus sp. AF24-32LB] |
1.68e-32 | 100 | 29.973 | WP_117675258 |
MULTISPECIES: hypothetical protein [unclassified Ruminococcus] hypothetical protein DWV90_02755 [Ruminococcus sp. AF13-37] hypothetical protein DWV87_03750 [Ruminococcus sp. AF13-28] |
2.76e-32 | 100 | 29.973 | WP_117844032 |
hypothetical protein [Ruminococcus sp. AM46-18] hypothetical protein DW958_03785 [Ruminococcus sp. AM46-18] |
3.1e-32 | 100 | 29.396 | WP_119252861 |
hypothetical protein [Blautia wexlerae] |
4.58e-32 | 100 | 30.495 | WP_026648296 |
hypothetical protein [Ruminococcus sp. AM28-41] hypothetical protein DW748_01005 [Ruminococcus sp. AM28-41] |
4.67e-32 | 100 | 30.959 | WP_118609305 |
MULTISPECIES: hypothetical protein [unclassified Ruminococcus] hypothetical protein DXA17_04195 [Ruminococcus sp. AM58-7XD] hypothetical protein DW776_05095 [Ruminococcus sp. AM30-15AC] hypothetical protein DW098_14615 [Ruminococcus sp. AM07-21] hypothetical protein DW022_04045 [Ruminococcus sp. AF37-6AT] hypothetical protein DWZ27_05615 [Ruminococcus sp. AF31-16BH] |
7.41e-32 | 100 | 30.959 | WP_118136642 |
hypothetical protein [Ruminococcus sp. AM23-1LB] hypothetical protein DW648_01220 [Ruminococcus sp. AM23-1LB] |
1.02e-31 | 100 | 28.571 | WP_118341601 |
hypothetical protein [Ruminococcus sp. AM40-10AC] hypothetical protein DW884_12970 [Ruminococcus sp. AM40-10AC] |
1.35e-31 | 100 | 28.571 | WP_118572124 |
hypothetical protein [Ruminococcus sp. AF41-9] hypothetical protein DW049_01065 [Ruminococcus sp. AF41-9] |
3.22e-28 | 100 | 31.680 | WP_119233028 |
hypothetical protein [Ruminococcus sp. AF21-42] hypothetical protein DWX83_05920 [Ruminococcus sp. AF21-42] |
1.55e-25 | 38 | 44.030 | WP_118509285 |
hypothetical protein [Blautia luti] hypothetical protein [Blautia luti DSM 14534] |
1.66e-25 | 38 | 44.030 | WP_154780828 |
MULTISPECIES: hypothetical protein [unclassified Blautia] hypothetical protein DWX98_10040 [Blautia sp. AF22-5LB] hypothetical protein DWX49_07065 [Blautia sp. AF19-34] |
3.38e-24 | 34 | 45.082 | WP_118576039 |
MULTISPECIES: hypothetical protein [unclassified Blautia] hypothetical protein DW177_03975 [Blautia sp. AM16-16B] hypothetical protein DW962_00535 [Blautia sp. AM46-5] |
4.08e-24 | 34 | 45.082 | WP_117523998 |
hypothetical protein [Blautia sp. SG-772] hypothetical protein C6W64_000925 [Blautia sp. SG-772] |
4.28e-24 | 34 | 45.082 | WP_106491830 |
Predicted membrane protein [uncultured Blautia sp.] |
4.28e-24 | 99 | 28.333 | SCH93710 |
hypothetical protein [Blautia sp. AM22-22LB] hypothetical protein DW266_04925 [Blautia sp. AM22-22LB] |
4.29e-24 | 34 | 45.082 | WP_118316202 |
MULTISPECIES: hypothetical protein [unclassified Blautia] hypothetical protein DWY34_06850 [Blautia sp. AF25-12LB] hypothetical protein DXD15_03420 [Blautia sp. TF11-31AT] |
8.46e-24 | 34 | 45.082 | WP_118567863 |
ABC-type uncharacterized transport system%2C permease component [uncultured Blautia sp.] |
1.03e-23 | 34 | 45.082 | SCI64739 |
hypothetical protein [Lachnospiraceae bacterium BSM-380-WT-5A] hypothetical protein [Lachnospiraceae bacterium BSM-380-WT-5A] |
1.11e-23 | 34 | 45.082 | WP_154432045 |
hypothetical protein [Ruminococcus sp. SR1/5] hypothetical protein CK1_32850 [Ruminococcus sp. SR1/5] |
1.53e-23 | 48 | 38.286 | WP_015526914 |
hypothetical protein [Lachnospiraceae bacterium] Uncharacterised protein [uncultured Blautia sp.] |
4.76e-23 | 99 | 28.056 | WP_148447493 |
hypothetical protein [Lachnospiraceae bacterium] |
6.57e-23 | 32 | 39.474 | HCO42222 |
hypothetical protein [Blautia sp. OF03-13] hypothetical protein DXA55_03150 [Blautia sp. OF03-13] |
7.53e-23 | 53 | 39.153 | WP_117813022 |
putative uncharacterized protein [Blautia sp. CAG:37] |
8.11e-23 | 32 | 39.474 | CDE64983 |
hypothetical protein [Blautia sp. OM06-15AC] hypothetical protein DXB83_05110 [Blautia sp. OM06-15AC] |
1.1e-22 | 32 | 38.596 | WP_118697332 |
hypothetical protein [Blautia sp. AF32-4BH] hypothetical protein DWZ44_08275 [Blautia sp. AF32-4BH] |
1.35e-22 | 32 | 38.596 | WP_117804622 |
hypothetical protein [Fusicatenibacter saccharivorans] ABC-type uncharacterized transport system%2C permease component [Fusicatenibacter saccharivorans] |
2.59e-22 | 32 | 38.596 | WP_055220762 |
hypothetical protein [Blautia sp. AM29-29] hypothetical protein DW769_12530 [Blautia sp. AM29-29] |
2.88e-22 | 32 | 38.596 | WP_118750447 |
hypothetical protein [Lachnospiraceae bacterium] |
3.13e-22 | 34 | 41.322 | HAV27628 |
hypothetical protein [Blautia sp. AF17-9LB] hypothetical protein DWX00_15480 [Blautia sp. AF17-9LB] |
3.46e-22 | 32 | 37.719 | WP_118595666 |
hypothetical protein [Blautia sp. AM47-4] hypothetical protein DW965_00560 [Blautia sp. AM47-4] |
3.46e-22 | 32 | 37.719 | WP_119197893 |
hypothetical protein [Blautia sp. AM42-2] hypothetical protein DW915_05820 [Blautia sp. AM42-2] |
3.5e-22 | 32 | 38.596 | WP_118741772 |
hypothetical protein [Fusicatenibacter saccharivorans] ABC-type uncharacterized transport system%2C permease component [Fusicatenibacter saccharivorans] |
3.57e-22 | 32 | 38.596 | WP_055227729 |
hypothetical protein [Blautia sp. OM05-6] hypothetical protein DXB71_01635 [Blautia sp. OM05-6] |
4.07e-22 | 32 | 37.719 | WP_118699818 |
hypothetical protein [Blautia sp. SC05B48] hypothetical protein EYS05_10565 [Blautia sp. SC05B48] |
6.9e-22 | 52 | 32.500 | WP_138277140 |
hypothetical protein [Blautia sp. SF-50] hypothetical protein SAMN02910433_00720 [Blautia sp. SF-50] |
7.11e-22 | 52 | 32.500 | WP_092069543 |
putative uncharacterized protein [Firmicutes bacterium CAG:424] |
8.01e-22 | 34 | 62.295 | CDC42864 |
hypothetical protein [Ruminococcus sp. OF02-6] hypothetical protein DXA48_03105 [Ruminococcus sp. OF02-6] |
8.59e-22 | 52 | 32.500 | WP_118513006 |
hypothetical protein [Ruminococcus sp. OF03-6AA] hypothetical protein DXA65_13610 [Ruminococcus sp. OF03-6AA] |
1.14e-21 | 48 | 35.465 | WP_119248248 |
hypothetical protein [Blautia sp. OF09-25XD] hypothetical protein DXA93_12785 [Blautia sp. OF09-25XD] |
1.34e-21 | 32 | 37.719 | WP_119208526 |
MULTISPECIES: hypothetical protein [Lachnospiraceae] hypothetical protein DW746_09060 [Blautia sp. AM28-36] hypothetical protein DW743_10175 [Blautia sp. AM28-27] hypothetical protein DW731_09370 [Blautia sp. AM28-10] |
1.35e-21 | 32 | 37.719 | WP_117761418 |
hypothetical protein [Blautia sp. AF14-40] |
1.38e-21 | 32 | 37.719 | WP_158579755 |
hypothetical protein [Blautia sp. AF19-1] hypothetical protein DWX26_06310 [Blautia sp. AF19-1] |
1.42e-21 | 32 | 37.719 | WP_118601074 |
hypothetical protein [Blautia sp. TM10-2] hypothetical protein DXD92_11345 [Blautia sp. TM10-2] |
1.43e-21 | 32 | 37.719 | WP_118640546 |
putative uncharacterized protein [Roseburia sp. CAG:471] |
1.63e-21 | 34 | 43.443 | CDD98759 |
hypothetical protein [Blautia sp. AM23-13AC] hypothetical protein DW642_13225 [Blautia sp. AM23-13AC] |
1.63e-21 | 32 | 37.719 | WP_117510468 |
MULTISPECIES: hypothetical protein [unclassified Blautia] hypothetical protein DWY63_03495 [Blautia sp. AF26-2] hypothetical protein DXB02_06755 [Blautia sp. OF11-22] |
1.63e-21 | 32 | 37.719 | WP_117801364 |
MULTISPECIES: hypothetical protein [unclassified Blautia] hypothetical protein DXD21_06175 [Blautia sp. TF12-12AT] hypothetical protein DXD26_04870 [Blautia sp. TF12-31AT] hypothetical protein DXD02_08460 [Blautia sp. TF10-30] |
1.75e-21 | 32 | 37.719 | WP_118666733 |
hypothetical protein [Blautia sp.] |
1.75e-21 | 48 | 35.465 | HBB47914 |
hypothetical protein [Ruminococcus sp. OM08-9BH] hypothetical protein DXC28_02900 [Ruminococcus sp. OM08-9BH] putative uncharacterized protein [Ruminococcus sp. CAG:17] |
1.8e-21 | 48 | 35.465 | WP_021977062 |
Uncharacterised protein [uncultured Blautia sp.] |
1.93e-21 | 48 | 35.465 | SCH41448 |
hypothetical protein [Ruminococcus sp. AM41-10BH] hypothetical protein DW894_06355 [Ruminococcus sp. AM41-10BH] |
1.93e-21 | 48 | 35.465 | WP_118169332 |
hypothetical protein [Blautia sp. AF34-10] hypothetical protein DWZ60_04815 [Blautia sp. AF34-10] |
1.95e-21 | 32 | 37.719 | WP_119221329 |
hypothetical protein [Blautia sp. AF19-13LB] hypothetical protein DWX32_11130 [Blautia sp. AF19-13LB] |
1.96e-21 | 32 | 37.719 | WP_118660040 |
MULTISPECIES: hypothetical protein [unclassified Ruminococcus] hypothetical protein DW851_07285 [Ruminococcus sp. AM36-5] hypothetical protein DW846_07280 [Ruminococcus sp. AM36-2AA] |
2.26e-21 | 48 | 35.465 | WP_118071088 |
hypothetical protein [Lachnospiraceae bacterium] |
2.77e-21 | 99 | 27.487 | HAE45286 |
hypothetical protein [Fusicatenibacter saccharivorans] hypothetical protein BHV85_01370 [Blautia sp. CAG:37_48_57] ABC-type uncharacterized transport system%2C permease component [Fusicatenibacter saccharivorans] |
3.18e-21 | 35 | 41.129 | WP_055266978 |
hypothetical protein [Blautia sp. KGMB01111] hypothetical protein ETP43_12325 [Blautia sp. KGMB01111] |
4.57e-21 | 34 | 43.443 | WP_129258351 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein DXA96_03840 [Lachnospiraceae bacterium OF09-33XD] |
5.22e-21 | 98 | 28.312 | WP_118643413 |
Uncharacterised protein [uncultured Ruminococcus sp.] |
1.42e-19 | 46 | 35.152 | SCH05475 |
hypothetical protein [Blautia obeum] hypothetical protein DXA56_06595 [Blautia obeum] |
2.36e-18 | 49 | 33.523 | WP_119200715 |
hypothetical protein [Blautia obeum] hypothetical protein RUMOBE_03269 [Blautia obeum ATCC 29174] uncharacterized protein BN639_01979 [Ruminococcus obeum CAG:39] hypothetical protein DXD81_13570 [Blautia obeum] hypothetical protein DXC87_04770 [Blautia obeum] hypothetical protein DXB81_12170 [Blautia obeum] |
2.36e-18 | 49 | 33.523 | WP_005424970 |
hypothetical protein [Blautia obeum] Uncharacterised protein [Blautia obeum] Uncharacterised protein [uncultured Ruminococcus sp.] |
2.55e-18 | 49 | 33.523 | WP_055056358 |
hypothetical protein [Blautia obeum] hypothetical protein DWY46_10005 [Blautia obeum] hypothetical protein DXA08_12710 [Blautia obeum] |
3.56e-18 | 49 | 32.955 | WP_118031435 |
hypothetical protein [Ruminococcus sp. AF17-22AC] hypothetical protein DWW86_09575 [Ruminococcus sp. AF17-22AC] |
4.67e-18 | 48 | 33.529 | WP_117942933 |
uncharacterized protein BN747_02124 [Firmicutes bacterium CAG:646] |
1.45e-16 | 34 | 39.516 | CCZ33523 |
hypothetical protein [Lachnospiraceae bacterium] |
6.55e-15 | 48 | 33.721 | WP_147597933 |
hypothetical protein [Blautia hansenii] |
1.35e-14 | 48 | 33.140 | WP_138270702 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_39 In bact CP040530.1
Seq (len = 10 ):
IIVIIPVQSQ
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|339242|-1|4531319-4531445
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.764471553092451
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_40 In bact CP040530.1
Seq (len = 362 ):
MAKKIAEQLIDTLVESGVERIYAVTGDSLNEVNEAVRKNNKIQWIHVRHEETGAYAAAAEAQLTGRIGCCAGSSGPGHVHLINGLYDAQRSGAPVIAIASTIPSGEFGTEYFQETNTIKLFNDCSYYNEVATTPGQFPRMLQSAIQTAITRKGVAVVGLPGDLAKASSVSVDSSVKNYPAPPEVCPAEEDLIQLAELLNNHKRITLFCGIGCRGAHEEVIALSEKLNAPVVYTFKGKMEVQYENPYEVGMTGLLGMPSGYYSMHEAEVLLMLGTDFPYSAFLPDDIKIAQIDIKPERLGRRAKVDIGLCGDVRMTIQALLRMLDPKTDDTFLLKQLKRYEGVKKDLAAYTENKGDHCCPIKI
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|248134|1|5859132-5860293
Transkriptom
91.0% of gene length expressed over median expression of contig.
ŝ
7.22604299023566
unique PSMS
11
unique PSMS
11
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
pyruvate dehydrogenase, partial [Bacteroides thetaiotaomicron]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
pyruvate dehydrogenase, partial [Bacteroides thetaiotaomicron] pyruvate dehydrogenase, partial [Bacteroides thetaiotaomicron VPI-5482] pyruvate dehydrogenase [Bacteroides thetaiotaomicron VPI-5482] pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 100 | 100.000 | WP_011108004 |
pyruvate oxidase [Bacteroides thetaiotaomicron] Pyruvate dehydrogenase [Bacteroides thetaiotaomicron] hypothetical protein BSIG_5896 [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 100.000 | WP_008767730 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] pyruvate dehydrogenase (cytochrome) [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.718 | WP_113748290 |
pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate dehydrogenase (cytochrome) [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.718 | WP_055221477 |
pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate dehydrogenase (cytochrome) [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.437 | WP_048693046 |
pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate dehydrogenase (quinone) [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.437 | WP_074858969 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.437 | KAB4451693 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.155 | WP_118307548 |
pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate oxidase [Bacteroides thetaiotaomicron] pyruvate dehydrogenase (cytochrome) [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.155 | WP_055300327 |
pyruvate oxidase [Bacteroides sp. AR20] pyruvate dehydrogenase (quinone) [Bacteroides sp. AR20] |
0.0 | 98 | 99.155 | WP_090615951 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.155 | KAB4462144 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.873 | WP_129655313 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 99.155 | KAB4485587 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. AM23-12] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. AM23-12] |
0.0 | 98 | 98.873 | WP_117578091 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.873 | WP_117978192 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.873 | WP_119213036 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.873 | WP_130042042 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.592 | WP_132062362 |
pyruvate dehydrogenase (cytochrome) [Bacteroides sp. 1_1_14] |
0.0 | 98 | 98.592 | EFI02535 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] pyruvate dehydrogenase (quinone) [Bacteroides thetaiotaomicron dnLKV9] |
0.0 | 98 | 98.592 | WP_016266919 |
pyruvate dehydrogenase [Bacteroides sp. 1_1_14] |
0.0 | 98 | 98.592 | WP_032850706 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.873 | KAB4825475 |
thiamine pyrophosphate enzyme, TPP binding domain protein [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.310 | KXT39300 |
pyruvate oxidase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.310 | WP_061473494 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] pyruvate dehydrogenase (ubiquinone) [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.028 | WP_143919657 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 98 | 98.592 | KAB4878070 |
MULTISPECIES: pyruvate oxidase [Bacteroides] pyruvate dehydrogenase (quinone) [Bacteroides faecis MAJ27] pyruvate oxidase [Bacteroides faecis] pyruvate oxidase [Bacteroides faecis] pyruvate oxidase [Bacteroides faecis] pyruvate oxidase [Bacteroides faecis] |
0.0 | 98 | 97.465 | WP_010539034 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides faecis] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides faecis] |
0.0 | 98 | 97.183 | WP_117615242 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 97 | 98.575 | KAB4290727 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 97 | 98.575 | KAB4447333 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides thetaiotaomicron] |
0.0 | 97 | 98.575 | KAB4265352 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides faecis] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides faecis] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides faecis] |
0.0 | 98 | 97.183 | WP_130061821 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides faecis] |
0.0 | 98 | 96.056 | WP_109114951 |
pyruvate oxidase [Bacteroides acidifaciens] |
0.0 | 98 | 93.239 | WP_044656161 |
thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides sp. 2_1_22] |
0.0 | 98 | 92.394 | EEZ01852 |
MULTISPECIES: pyruvate oxidase [Bacteroides] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.676 | WP_049703531 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.676 | WP_117810350 |
MULTISPECIES: pyruvate oxidase [Bacteroides] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides xylanisolvens SD CC 2a] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides xylanisolvens SD CC 1b] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides sp. D1] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.394 | WP_004314000 |
hypothetical protein HMPREF9009_04573 [Bacteroides sp. 3_1_13] |
0.0 | 98 | 92.676 | KMW75468 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroidaceae bacterium] |
0.0 | 98 | 92.676 | WP_148364623 |
pyruvate oxidase [Bacteroides xylanisolvens] pyruvate dehydrogenase (quinone) [Bacteroides xylanisolvens] |
0.0 | 98 | 92.394 | WP_074909647 |
pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.676 | WP_087322740 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.394 | WP_151927878 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.394 | WP_118196402 |
MULTISPECIES: pyruvate dehydrogenase [Bacteroides] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides finegoldii] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides finegoldii] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides finegoldii] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides finegoldii] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides finegoldii] |
0.0 | 98 | 92.394 | WP_055278932 |
MULTISPECIES: pyruvate oxidase [Bacteroides] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides ovatus str. 3725 D1 iv] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides fragilis str. 3725 D9 ii] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides ovatus str. 3725 D9 iii] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] |
0.0 | 98 | 92.394 | WP_032843878 |
pyruvate oxidase [Bacteroides finegoldii] |
0.0 | 98 | 92.394 | WP_029425774 |
MULTISPECIES: pyruvate oxidase [Bacteroides] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] |
0.0 | 98 | 92.394 | WP_044918898 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.394 | WP_134992996 |
MULTISPECIES: pyruvate oxidase [Bacteroides] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] pyruvate oxidase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.394 | WP_032851109 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. OF03-11BH] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. OF03-11BH] |
0.0 | 98 | 92.394 | WP_120078944 |
hypothetical protein HMPREF1069_03600 [Bacteroides ovatus CL02T12C04] pyruvate dehydrogenase (ubiquinone) [Bacteroides ovatus] pyruvate dehydrogenase (quinone) [Bacteroides ovatus] |
0.0 | 98 | 92.394 | EIY60928 |
pyruvate dehydrogenase (cytochrome) [Bacteroides sp. D22] pyruvate dehydrogenase (cytochrome) [Bacteroides xylanisolvens] |
0.0 | 98 | 92.394 | EFI14739 |
pyruvate dehydrogenase (cytochrome) [Bacteroides finegoldii] |
0.0 | 98 | 92.394 | CUO33012 |
Pyruvate dehydrogenase [ubiquinone] [uncultured Bacteroides sp.] |
0.0 | 98 | 92.394 | SCI16051 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] |
0.0 | 98 | 92.655 | KAB1329330 |
pyruvate oxidase [Bacteroides xylanisolvens] Pyruvate oxidase [ubiquinone, cytochrome] [Bacteroides xylanisolvens SD CC 2a] |
0.0 | 98 | 92.113 | WP_032810888 |
pyruvate dehydrogenase (cytochrome) [Bacteroides xylanisolvens XB1A] |
0.0 | 98 | 92.394 | CBK66602 |
thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides sp. 2_2_4] pyruvate dehydrogenase (cytochrome) [Bacteroides sp. 3_1_23] hypothetical protein HMPREF1070_04928 [Bacteroides ovatus CL03T12C18] uncharacterized protein BN541_02767 [Bacteroides ovatus CAG:22] |
0.0 | 98 | 92.394 | EEO53689 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] |
0.0 | 98 | 92.113 | WP_149968817 |
MULTISPECIES: pyruvate oxidase [Bacteroides] pyruvate oxidase [Bacteroides sp. AM16-13] pyruvate oxidase [Bacteroides sp. AF32-8BH] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.655 | WP_032842260 |
hypothetical protein HMPREF1057_00034 [Bacteroides finegoldii CL09T03C10] |
0.0 | 98 | 92.394 | EKJ92736 |
pyruvate oxidase [Bacteroides congonensis] |
0.0 | 98 | 92.676 | WP_073342686 |
Pyruvate dehydrogenase [Bacteroides ovatus] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides ovatus ATCC 8483] pyruvate dehydrogenase (cytochrome) [Bacteroides ovatus V975] pyruvate dehydrogenase (cytochrome) [Bacteroides ovatus] pyruvate dehydrogenase (quinone) [Bacteroides ovatus] |
0.0 | 98 | 92.394 | ALJ46522 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.373 | WP_151936297 |
hypothetical protein HMPREF0127_04152 [Bacteroides sp. 1_1_30] thiamine pyrophosphate enzyme, TPP binding domain protein [Bacteroides ovatus] |
0.0 | 98 | 92.655 | EGM97379 |
MULTISPECIES: ubiquinone-dependent pyruvate dehydrogenase [unclassified Bacteroides] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. HF-5141] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. HF-5092] |
0.0 | 98 | 92.373 | WP_143259335 |
ubiquinone-dependent pyruvate dehydrogenase [Parabacteroides distasonis] |
0.0 | 98 | 92.394 | MSB76337 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] |
0.0 | 98 | 93.803 | WP_122118200 |
MULTISPECIES: ubiquinone-dependent pyruvate dehydrogenase [unclassified Bacteroides] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. HF-5287] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. HF-5300] |
0.0 | 98 | 92.113 | WP_143868020 |
pyruvate oxidase [Bacteroides ovatus] thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides ovatus SD CMC 3f] |
0.0 | 98 | 92.113 | WP_004311767 |
thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein, partial [Bacteroides fragilis str. 3397 T10] |
0.0 | 98 | 92.373 | EXY32066 |
pyruvate oxidase [Bacteroides finegoldii] |
0.0 | 98 | 92.113 | OKZ22347 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] |
0.0 | 98 | 92.113 | WP_149951862 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] |
0.0 | 98 | 92.373 | WP_138343121 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] |
0.0 | 98 | 92.113 | WP_118032714 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.113 | WP_151932771 |
pyruvate oxidase [Bacteroides caccae] pyruvate oxidase [Bacteroides caccae] pyruvate oxidase [Bacteroides caccae] pyruvate oxidase [Bacteroides caccae] pyruvate oxidase [Bacteroides caccae] pyruvate oxidase [Bacteroides caccae] |
0.0 | 98 | 93.803 | WP_032855343 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] pyruvate oxidase [Bacteroides sp. 43_46] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] |
0.0 | 98 | 93.803 | WP_122295626 |
ubiquinone-dependent pyruvate dehydrogenase [Parabacteroides distasonis] |
0.0 | 98 | 92.373 | MRZ17706 |
pyruvate oxidase [Bacteroides xylanisolvens] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides xylanisolvens] |
0.0 | 98 | 92.373 | WP_032812123 |
hypothetical protein HMPREF1074_04201 [Bacteroides xylanisolvens CL03T12C04] |
0.0 | 98 | 92.373 | EIY84246 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] |
0.0 | 98 | 93.521 | WP_149928734 |
pyruvate oxidase [Bacteroides caccae] pyruvate oxidase [Bacteroides caccae] pyruvate oxidase [Bacteroides caccae] pyruvate dehydrogenase (cytochrome) [Bacteroides caccae] |
0.0 | 98 | 93.521 | WP_055256087 |
thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides caccae ATCC 43185] thiamine pyrophosphate enzyme C-terminal TPP binding domain protein [Bacteroides caccae CAG:21] |
0.0 | 98 | 93.803 | EDM19941 |
pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] |
0.0 | 98 | 93.521 | WP_055171983 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides caccae] |
0.0 | 98 | 93.521 | WP_122264850 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] |
0.0 | 98 | 92.090 | HCJ23957 |
pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] pyruvate oxidase [Bacteroides ovatus] |
0.0 | 98 | 91.831 | WP_032852211 |
pyruvate oxidase [Bacteroides caccae] |
0.0 | 98 | 93.239 | WP_032838182 |
pyruvate dehydrogenase (cytochrome) [Bacteroides caccae] |
0.0 | 98 | 93.521 | CUP31769 |
hypothetical protein HMPREF1061_02786 [Bacteroides caccae CL03T12C61] |
0.0 | 98 | 93.239 | EIY19213 |
pyruvate oxidase [Bacteroides xylanisolvens] |
0.0 | 97 | 92.308 | WP_074705331 |
hypothetical protein HMPREF1017_04564 [Bacteroides ovatus 3_8_47FAA] |
0.0 | 98 | 91.831 | EGM98670 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] ubiquinone-dependent pyruvate dehydrogenase [Bacteroides ovatus] |
0.0 | 98 | 91.549 | WP_149991046 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides sp. KCTC 15687] pyruvate dehydrogenase [Bacteroides sp. KCTC 15687] |
0.0 | 98 | 88.451 | WP_125042419 |
hypothetical protein BSGG_3029, partial [Bacteroides sp. D2] |
0.0 | 96 | 92.241 | EFS32329 |
pyruvate oxidase [Bacteroides bouchesdurhonensis] |
0.0 | 98 | 88.451 | WP_077153443 |
thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein [Bacteroides finegoldii DSM 17565] |
0.0 | 96 | 91.931 | EEX47123 |
ubiquinone-dependent pyruvate dehydrogenase [Bacteroides bouchesdurhonensis] |
0.0 | 98 | 87.887 | WP_148371619 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_41 In blautia CP039126.1
Seq (len = 36 ):
IPFKGMGESERGSCDAELPGKMFRLRRSFLQRRCLH
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|107773|1|2810287-2810437
Transkriptom
50.0% of gene length expressed over median expression of contig.
ŝ
2.886725307535649
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_42 In bact CP040530.1
Seq (len = 61 ):
IYAGAALTVEAKVDMKAASRPANNNPANPAGTYRVIRWGRIVSKSVRVTSICVSPPSSLKK
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|474785|-1|1137320-1137515
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.876148359032914
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_43 In bact CP040530.1
Seq (len = 7 ):
MEDLFNR
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|178575|1|4164814-4164847
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9882886203372616
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_44 In lacto CP039121.1
Seq (len = 24 ):
MFIFQDLGHILHIDKLRLGDIPLI
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|147293|1|2793379-2793457
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.6736641390712483
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_45 In ery NZ_CP036346.1
Seq (len = 23 ):
MVTSLLHKVMVLDHIKSYLSNGL
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|339589|-1|1463934-1464045
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9465373950745444
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_46 In ery NZ_CP036346.1
Seq (len = 33 ):
ITENHWNKENRIQHYWHSKNQWFIDIKQIRNKS
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|125157|1|1810774-1810939
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.8990553708835707
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_47 In blautia CP039126.1
Seq (len = 81 ):
MKDEMEAKKAEGKAEGKAEGKAEGRAEGKADSVLELLCDLGEVSEKLKKTIREQKNQDVLNCWLKYAAKADSIEEFEQRIR
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|40167|1|1046723-1047362
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
8.838532171426944
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
MULTISPECIES: 3-isopropylmalate dehydrogenase [Blautia]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Clostridiales bacterium VE202-06] |
8.33e-46 | 100 | 98.765 | WP_029467825 |
3-isopropylmalate dehydrogenase [Blautia coccoides] hypothetical protein EV205_103184 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
7.57e-42 | 100 | 95.062 | WP_115623474 |
3-isopropylmalate dehydrogenase [Blautia producta] hypothetical protein PMF13cell1_05544 [Blautia producta] |
2.4e-41 | 100 | 93.827 | WP_130182843 |
hypothetical protein [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
4.51e-22 | 90 | 63.014 | WP_158348878 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [Blautia] |
9.61e-21 | 100 | 58.025 | WP_095174847 |
hypothetical protein [Blautia producta] |
5.65e-20 | 100 | 56.790 | WP_148391799 |
hypothetical protein PMF13cell1_00621 [Blautia producta] |
2.07e-19 | 100 | 56.790 | QBE95119 |
hypothetical protein [Blautia producta] |
2.51e-19 | 100 | 56.790 | WP_130179762 |
conserved hypothetical protein (putative transposase or invertase) [Hespellia stercorisuis DSM 15480] |
8.84e-19 | 93 | 57.333 | SHK51082 |
3-isopropylmalate dehydrogenase [Blautia producta] |
9.94e-19 | 100 | 58.025 | WP_148394072 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [unclassified Blautia] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. AF13-16] |
9.94e-19 | 100 | 58.025 | WP_118594227 |
Rpn family recombination-promoting nuclease/putative transposase, partial [Hespellia stercorisuis] |
1.03e-18 | 93 | 57.333 | WP_143160752 |
hypothetical protein [Clostridiales bacterium] |
1.57e-18 | 90 | 56.757 | HCS75708 |
3-isopropylmalate dehydrogenase [Blautia marasmi] |
1.57e-18 | 100 | 56.790 | WP_104803872 |
hypothetical protein [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
2.45e-18 | 90 | 61.644 | WP_158342368 |
3-isopropylmalate dehydrogenase, partial [Blautia producta] |
4.64e-18 | 100 | 54.321 | POP35903 |
hypothetical protein [Blautia producta] |
4.65e-18 | 80 | 63.077 | WP_033143667 |
hypothetical protein [Clostridiales bacterium VE202-06] |
1.48e-17 | 98 | 55.696 | WP_029470741 |
MULTISPECIES: hypothetical protein [Blautia] |
2.71e-17 | 100 | 56.790 | WP_095175458 |
3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] |
2.75e-17 | 100 | 54.321 | WP_118593835 |
3-isopropylmalate dehydrogenase, partial [Blautia producta] |
2.83e-17 | 89 | 56.944 | POP36366 |
Uncharacterised protein [uncultured Eubacterium sp.] |
3.41e-17 | 98 | 51.899 | SCJ87943 |
3-isopropylmalate dehydrogenase [Blautia producta] hypothetical protein PMF13cell1_00620 [Blautia producta] |
4.13e-17 | 89 | 58.333 | WP_130179761 |
hypothetical protein [Eubacteriaceae bacterium] |
6.46e-17 | 98 | 51.899 | WP_148492251 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [unclassified Blautia] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. AF13-16] |
1.49e-16 | 89 | 56.944 | WP_118594065 |
3-isopropylmalate dehydrogenase [Blautia producta] |
1.7e-16 | 89 | 56.944 | WP_148391800 |
hypothetical protein C804_00221 [Lachnospiraceae bacterium A4] |
2.34e-16 | 89 | 55.556 | EOS37111 |
hypothetical protein, partial [Lachnospiraceae bacterium A4] |
2.58e-16 | 89 | 55.556 | WP_034219711 |
Rpn family recombination-promoting nuclease/putative transposase [Acetatifactor muris] hypothetical protein AMURIS_00736 [Acetatifactor muris] |
1.03e-15 | 80 | 60.000 | WP_146039967 |
Rpn family recombination-promoting nuclease/putative transposase [Frisingicoccus caecimuris] putative transposase/invertase (TIGR01784 family) [Frisingicoccus caecimuris] |
1.06e-15 | 98 | 48.101 | WP_132092907 |
hypothetical protein [Blautia producta] |
1.36e-15 | 85 | 55.072 | WP_033144180 |
hypothetical protein [Lachnospiraceae bacterium] |
5.19e-15 | 98 | 48.101 | HAP21926 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia marasmi] |
1.1e-14 | 94 | 55.263 | WP_104802557 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] |
1.38e-14 | 94 | 55.263 | WP_095173739 |
hypothetical protein C804_00223, partial [Lachnospiraceae bacterium A4] |
1.63e-14 | 84 | 54.412 | EOS37023 |
3-isopropylmalate dehydrogenase [Blautia coccoides] hypothetical protein EV205_1139 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
8.58e-14 | 98 | 53.165 | WP_115624245 |
hypothetical protein [Hungateiclostridium saccincola] |
1.19e-13 | 80 | 53.846 | WP_133161638 |
3-isopropylmalate dehydrogenase, partial [Blautia producta] 3-isopropylmalate dehydrogenase, partial [Blautia producta] |
1.67e-13 | 88 | 57.746 | WP_103733130 |
3-isopropylmalate dehydrogenase [Blautia producta] hypothetical protein PMF13cell1_00206 [Blautia producta] |
1.8e-13 | 98 | 51.899 | WP_130179517 |
hypothetical protein B9R14_09230 [Hungateiclostridium saccincola] |
2.02e-13 | 80 | 53.846 | PQQ66906 |
hypothetical protein CBFG_04055 [Clostridiales bacterium 1_7_47FAA] |
2.35e-13 | 94 | 48.684 | EEQ60343 |
MULTISPECIES: hypothetical protein [unclassified Clostridiales (miscellaneous)] |
2.4e-13 | 94 | 48.684 | WP_025482579 |
hypothetical protein D7V81_01225 [bacterium 1XD21-70] |
6.03e-13 | 86 | 51.429 | RKI17894 |
hypothetical protein [bacterium 1XD21-70] |
6.18e-13 | 86 | 51.429 | WP_147434927 |
hypothetical protein C804_02285 [Lachnospiraceae bacterium A4] |
6.93e-13 | 89 | 52.778 | EOS33098 |
hypothetical protein [Lachnospiraceae bacterium A4] |
7.26e-13 | 89 | 52.778 | WP_034223450 |
hypothetical protein B5F07_06845, partial [Lachnoclostridium sp. An169] |
1.11e-12 | 88 | 47.887 | OUP84546 |
hypothetical protein B5F18_12340, partial [Lachnoclostridium sp. An181] |
1.36e-12 | 81 | 51.515 | OUP47004 |
hypothetical protein [Hungatella hathewayi] hypothetical protein HMPREF9473_01765 [ [Hungatella hathewayi WAL-18680] |
1.82e-12 | 84 | 52.941 | WP_006779747 |
hypothetical protein [Hungateiclostridium alkalicellulosi] hypothetical protein Cloal_1441 [Hungateiclostridium alkalicellulosi] |
2.31e-12 | 91 | 50.000 | WP_148891090 |
putative uncharacterized protein [Dorea sp. CAG:105] |
2.42e-12 | 84 | 50.000 | CCX75710 |
hypothetical protein [Dorea sp. AM10-31] |
2.84e-12 | 81 | 51.515 | WP_147323697 |
MULTISPECIES: 3-isopropylmalate dehydrogenase [Blautia] 3-isopropylmalate dehydrogenase [Blautia producta] 3-isopropylmalate dehydrogenase [Blautia sp. OF01-4LB] 3-isopropylmalate dehydrogenase [Blautia sp. AF13-16] |
2.92e-12 | 100 | 45.679 | WP_103731296 |
hypothetical protein [Blautia producta] |
3.17e-12 | 100 | 45.679 | WP_033141946 |
Rpn family recombination-promoting nuclease/putative transposase [bacterium D16-50] Rpn family recombination-promoting nuclease/putative transposase [bacterium D16-50] |
3.2e-12 | 84 | 51.471 | WP_120477496 |
hypothetical protein [[Ruminococcus] gnavus] hypothetical protein DW865_08435 [[Ruminococcus] gnavus] |
3.32e-12 | 100 | 45.882 | WP_118038795 |
hypothetical protein DW125_07805 [Dorea sp. AM10-31] |
3.44e-12 | 81 | 51.515 | RGF22681 |
hypothetical protein [Dorea sp. OM07-5] hypothetical protein DXC04_07115 [Dorea sp. OM07-5] |
6.97e-12 | 81 | 50.000 | WP_118660598 |
hypothetical protein [[Clostridium] glycyrrhizinilyticum] |
7.19e-12 | 99 | 46.250 | WP_157050183 |
hypothetical protein [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
7.34e-12 | 77 | 59.677 | WP_158348171 |
putative uncharacterized protein [Dorea sp. CAG:105] |
9.39e-12 | 88 | 50.704 | CCX75825 |
hypothetical protein [Drancourtella sp. An12] hypothetical protein B5E64_16470 [Drancourtella sp. An12] |
1.05e-11 | 88 | 47.887 | WP_087169555 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] hypothetical protein HMPREF0988_01364 [Lachnospiraceae bacterium 1_4_56FAA] |
1.39e-11 | 77 | 50.000 | WP_009267309 |
hypothetical protein C804_01403 [Lachnospiraceae bacterium A4] |
1.42e-11 | 79 | 53.125 | EOS34754 |
hypothetical protein [Dorea sp. AM13-35] hypothetical protein DW152_07780 [Dorea sp. AM13-35] |
1.43e-11 | 84 | 50.000 | WP_118288352 |
hypothetical protein [Clostridiaceae bacterium] |
1.64e-11 | 96 | 42.308 | WP_158352584 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia marasmi] |
2.11e-11 | 77 | 53.226 | WP_104802816 |
hypothetical protein [Lachnospiraceae bacterium A4] hypothetical protein C804_06574 [Lachnospiraceae bacterium A4] |
2.34e-11 | 84 | 52.941 | WP_016285037 |
hypothetical protein [Lachnospiraceae bacterium A4] |
2.35e-11 | 79 | 53.125 | WP_157496161 |
hypothetical protein [Microbispora sp. GKU 823] hypothetical protein B1L11_40075 [Microbispora sp. GKU 823] |
2.48e-11 | 88 | 52.778 | WP_079320388 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] hypothetical protein A4V09_10170 [Blautia sp. YL58] hypothetical protein ADH70_008620 [Blautia coccoides] |
2.89e-11 | 79 | 53.125 | WP_065542278 |
hypothetical protein [Lachnospiraceae bacterium A4] hypothetical protein C804_06573 [Lachnospiraceae bacterium A4] |
3.96e-11 | 84 | 52.941 | WP_016285036 |
hypothetical protein [Pseudoflavonifractor sp. BSD2780061688st1 E11] |
4.83e-11 | 88 | 42.529 | WP_138374007 |
hypothetical protein [Lachnospiraceae bacterium MD335] hypothetical protein C809_01250 [Lachnospiraceae bacterium MD335] |
5.57e-11 | 86 | 51.429 | WP_016299959 |
hypothetical protein [Dorea sp. AM13-35] hypothetical protein DW152_11405 [Dorea sp. AM13-35] |
6.78e-11 | 86 | 48.571 | WP_118288672 |
hypothetical protein [Murimonas intestini] |
7.29e-11 | 77 | 43.548 | WP_148409504 |
Rpn family recombination-promoting nuclease/putative transposase [Dorea sp. 5-2] hypothetical protein C817_03326 [Dorea sp. 5-2] |
8.11e-11 | 80 | 49.231 | WP_016220023 |
hypothetical protein [[Ruminococcus] gnavus] hypothetical protein DWX36_00455 [[Ruminococcus] gnavus] |
8.91e-11 | 100 | 43.529 | WP_118046355 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] hypothetical protein C3R19_09010 [Blautia producta] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. OF01-4LB] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. AF13-16] |
9.93e-11 | 79 | 48.438 | WP_103731698 |
hypothetical protein [[Ruminococcus] gnavus] hypothetical protein DWY23_05105 [[Ruminococcus] gnavus] |
9.94e-11 | 100 | 43.529 | WP_118005828 |
putative uncharacterized protein [Lachnospiraceae bacterium CAG:215] |
1.1e-10 | 72 | 53.448 | CDA98382 |
hypothetical protein DXA36_32500, partial [Eisenbergiella sp. OF01-20] |
1.14e-10 | 91 | 48.649 | RHP77887 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia producta] |
1.17e-10 | 79 | 48.438 | WP_148393401 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] hypothetical protein DW655_08280 [Lachnospiraceae bacterium AM23-2LB] hypothetical protein DW887_01920 [Lachnospiraceae bacterium AM40-2BH] |
1.23e-10 | 86 | 47.143 | WP_117550669 |
MULTISPECIES: hypothetical protein [unclassified Dorea] hypothetical protein DW125_13745 [Dorea sp. AM10-31] hypothetical protein DXC04_13895 [Dorea sp. OM07-5] |
1.27e-10 | 88 | 46.479 | WP_117538508 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] hypothetical protein A4V09_02010 [Blautia sp. YL58] hypothetical protein ADH70_000330 [Blautia coccoides] |
1.29e-10 | 74 | 55.000 | WP_065540869 |
hypothetical protein [Microbispora rosea] |
1.38e-10 | 79 | 56.923 | WP_030506637 |
Rpn family recombination-promoting nuclease/putative transposase [Eisenbergiella tayi] PD-(D/E)XK nuclease family transposase [Eisenbergiella tayi] |
1.59e-10 | 85 | 49.275 | WP_081329757 |
hypothetical protein HMPREF0994_04092, partial [Lachnospiraceae bacterium 3_1_57FAA_CT1] |
1.7e-10 | 70 | 54.386 | EGN37095 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] hypothetical protein HMPREF0988_01375 [Lachnospiraceae bacterium 1_4_56FAA] |
2.08e-10 | 69 | 53.571 | WP_009267320 |
3-isopropylmalate dehydrogenase [Clostridiales bacterium TF09-2AC] 3-isopropylmalate dehydrogenase [Clostridiales bacterium TF09-2AC] |
2.5e-10 | 94 | 45.455 | WP_120058570 |
3-isopropylmalate dehydrogenase [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
2.51e-10 | 70 | 56.140 | WP_158343351 |
Rpn family recombination-promoting nuclease/putative transposase [Eisenbergiella tayi] PD-(D/E)XK nuclease family transposase [Eisenbergiella tayi] |
2.69e-10 | 96 | 47.436 | WP_081331456 |
Rpn family recombination-promoting nuclease/putative transposase [Clostridiaceae bacterium MS3] |
2.88e-10 | 96 | 47.436 | WP_082042315 |
hypothetical protein B5F07_10405 [Lachnoclostridium sp. An169] |
2.91e-10 | 83 | 49.254 | OUP83669 |
Rpn family recombination-promoting nuclease/putative transposase, partial [Lachnoclostridium sp. An169] |
2.96e-10 | 83 | 49.254 | WP_140398002 |
hypothetical protein BHV88_23340 [Clostridiales bacterium 41_12_two_minus] hypothetical protein [Lachnospiraceae bacterium] |
3.02e-10 | 81 | 48.485 | OKZ61242 |
hypothetical protein [Clostridiaceae bacterium] Uncharacterised protein [uncultured Clostridium sp.] |
3.19e-10 | 73 | 52.542 | WP_158347769 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] |
3.45e-10 | 75 | 47.541 | WP_009461483 |
hypothetical protein [Eisenbergiella sp. OF01-20] hypothetical protein DXA36_30495 [Eisenbergiella sp. OF01-20] |
4.46e-10 | 80 | 50.769 | WP_118683032 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_48 In bifi AE014295.3
Seq (len = 71 ):
MLRRGCQPYSQGKQQADNGGQRDYGIHTPLPFLSPLTRLLTPPAGTSGFVATPIKQQWCIHEIPPHSVSVM
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|91367|-1|440678-441116
Transkriptom
33.0% of gene length expressed over median expression of contig.
ŝ
2.4213607900319274
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein BL105A_1024 [Bifidobacterium longum] |
1.48e-45 | 100 | 100.000 | BAP83656 |
Hypothetical protein BBMN68_364 [Bifidobacterium longum subsp. longum BBMN68] |
5.89e-45 | 100 | 100.000 | ADQ03073 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{no overlap with annotation}
Candidate nov_psm6_49 In ecoli U00096.3
Seq (len = 85 ):
MVSSSASNVVNCETKQRTQFECIYFSQYWAKGDFIAKRAPIGQWEPYSEESLLGIIVTSVCRIKVAMLKPEPPRDPHIPLMGDFN
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|173739|-1|4506628-4507036
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.7418418066592056
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
outer membrane protein F [Escherichia coli S17]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
outer membrane porin truncated homolog b1966 [similarity] - Escherichia coli (strain K-12) [Escherichia coli] outer membrane protein F [Escherichia coli DH1] hypothetical protein Eco34g_07390 [Escherichia coli] |
1.61e-83 | 100 | 100.000 | B64961 |
Porin OmpN [Escherichia coli] porin OmpN [Escherichia coli XH001] outer membrane protein F [Escherichia coli J53] gram-negative porin family protein [Escherichia coli 3-373-03_S4_C2] gram-negative porin family protein [Escherichia coli 3-373-03_S4_C1] gram-negative porin family protein [Escherichia coli 3-373-03_S4_C3] outer membrane protein F [Escherichia coli NCTC 50110] putative outer membrane protein YedS [Escherichia coli KRX] |
1.66e-83 | 100 | 100.000 | APQ21132 |
outer membrane protein F [Escherichia coli S17] |
2.09e-83 | 100 | 100.000 | EMD11316 |
Outer membrane protein N precursor [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] |
4.12e-82 | 100 | 100.000 | RDS30740 |
hypothetical protein ECGSH8M2_017290 [Escherichia coli] |
7.01e-82 | 100 | 97.541 | BBJ91192 |
Porin OmpN [Escherichia coli] |
6.19e-81 | 100 | 100.000 | VFT66161 |
porin, partial [Escherichia coli] |
8.98e-81 | 100 | 100.000 | WP_134354331 |
porin [Escherichia coli] porin [Shigella sonnei] porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] |
2.02e-80 | 100 | 100.000 | WP_094317860 |
porin [Escherichia coli] outer membrane protein S1 [Escherichia coli KTE196] outer membrane protein S1 [Escherichia coli KTE117] outer membrane porin OmpK36 [Escherichia coli UMEA 3124-1] outer membrane protein N [Escherichia coli 2-011-08_S1_C2] porin [Escherichia coli] |
2.2e-80 | 100 | 100.000 | WP_001613326 |
porin [Escherichia coli] outer membrane porin OmpK36 [Escherichia coli UMEA 3292-1] outer membrane protein N [Escherichia coli 3-475-03_S3_C2] Porin OmpN [Escherichia coli] |
2.68e-80 | 100 | 100.000 | WP_021569420 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] Porin OmpN [Escherichia coli] outer membrane pore protein [Escherichia coli] |
2.89e-80 | 100 | 100.000 | WP_063077715 |
porin [Escherichia coli] |
3.27e-80 | 100 | 100.000 | ORT29990 |
putative outer membrane protein YedS [Escherichia coli TA447] |
4.93e-80 | 100 | 100.000 | OSK93589 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
9.13e-80 | 100 | 98.361 | WP_077580821 |
porin [Escherichia coli] porin [Escherichia coli] outer membrane pore protein [Escherichia coli] |
1.04e-79 | 100 | 99.180 | WP_034173510 |
porin [Escherichia sp. HH41S] |
1.12e-79 | 100 | 98.361 | MXE44768 |
porin, partial [Escherichia coli] |
1.17e-79 | 100 | 97.541 | WP_103722693 |
porin OmpC [Escherichia coli] |
1.17e-79 | 100 | 98.361 | WP_140415029 |
porin [Escherichia coli] |
1.19e-79 | 100 | 98.361 | WP_089621242 |
MULTISPECIES: porin [Escherichia] gram-negative porin [Escherichia coli M863] gram-negative porin [Escherichia coli TW10509] gram-negative porin [Escherichia coli 1.2741] outer membrane porin OmpK36 [Escherichia coli UMEA 3139-1] outer membrane protein N [Escherichia coli 2-156-04_S3_C2] porin [Escherichia sp. HH26CH] Putative outer membrane protein YedS [Escherichia coli D6-113.11] |
1.23e-79 | 100 | 98.361 | WP_000824399 |
porin [Escherichia coli] porin [Shigella sonnei] |
1.27e-79 | 100 | 98.361 | WP_094319812 |
MULTISPECIES: porin [Escherichia] outer membrane protein N [Escherichia coli STEC_7v] |
1.3e-79 | 100 | 98.361 | WP_000824396 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.34e-79 | 100 | 98.361 | OWG44875 |
porin OmpC [Escherichia coli] |
1.4e-79 | 100 | 98.361 | WP_140422000 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.5e-79 | 100 | 98.361 | WP_077466898 |
porin [Escherichia coli] |
1.58e-79 | 100 | 98.361 | WP_115738600 |
porin [Escherichia coli] |
1.67e-79 | 100 | 98.361 | PAY72462 |
porin [Escherichia coli] |
1.76e-79 | 100 | 98.361 | OTB67451 |
porin [Escherichia coli] |
1.92e-79 | 100 | 98.361 | OWR35882 |
porin [Escherichia sp. MOD1-EC7003] |
3.23e-79 | 100 | 99.180 | WP_105274963 |
porin [Escherichia coli] |
5.2e-79 | 100 | 98.361 | WP_097715359 |
porin [Escherichia coli] |
5.32e-79 | 100 | 97.541 | WP_072859436 |
porin [Escherichia coli] porin [Escherichia coli] |
5.74e-79 | 100 | 97.541 | WP_127471796 |
porin [Escherichia coli] |
1.32e-78 | 100 | 97.541 | MHY37809 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.32e-78 | 100 | 97.541 | WP_103773355 |
porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] |
1.32e-78 | 100 | 97.541 | WP_157703551 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.34e-78 | 100 | 97.541 | WP_105165967 |
porin [Escherichia coli] |
1.35e-78 | 100 | 97.541 | WP_097753355 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.4e-78 | 100 | 97.541 | WP_114455590 |
MULTISPECIES: porin [Enterobacteriaceae] porin [Shigella sonnei] |
1.4e-78 | 100 | 97.541 | WP_096099427 |
porin [Escherichia coli] putative outer membrane protein YedS [Escherichia coli H383] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.41e-78 | 100 | 97.541 | WP_024224580 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli 2865200] outer membrane protein N [Escherichia coli 2780750] outer membrane protein N [Escherichia coli MP020980.2] outer membrane protein N [Escherichia coli 174900] outer membrane protein N [Escherichia coli MP021561.3] outer membrane protein N [Escherichia coli MP020980.1] outer membrane porin OmpK36 [Escherichia coli HVH 139 (4-3192644)] Outer membrane protein C precursor [Escherichia coli CE516] |
1.41e-78 | 100 | 97.541 | WP_001422414 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
1.41e-78 | 100 | 97.541 | WP_074534877 |
porin [Escherichia coli] |
1.41e-78 | 100 | 97.541 | WP_112916226 |
porin OmpC [Escherichia coli] |
1.41e-78 | 100 | 97.541 | WP_139500733 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli 2-427-07_S4_C1] |
1.48e-78 | 100 | 97.541 | WP_032202509 |
porin [Escherichia coli] |
1.49e-78 | 100 | 97.541 | MXD43096 |
porin [Escherichia coli] |
1.53e-78 | 100 | 97.541 | WP_109850892 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli 2788150] outer membrane protein N [Escherichia coli P0299917.2] outer membrane protein N [Escherichia coli P0299917.3] outer membrane protein N [Escherichia coli P0299917.5] outer membrane protein N [Escherichia coli P0299917.8] outer membrane protein N [Escherichia coli P0299917.6] outer membrane protein N [Escherichia coli P0299917.7] outer membrane protein N [Escherichia coli P0299917.9] outer membrane protein N [Escherichia coli 2-177-06_S4_C2] |
1.61e-78 | 100 | 97.541 | WP_001475434 |
porin [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] |
1.76e-78 | 100 | 97.541 | WP_053887115 |
porin [Escherichia coli] |
1.94e-78 | 100 | 97.541 | WP_112928350 |
porin [Escherichia coli] outer membrane pore protein [Escherichia coli] outer membrane pore protein [Escherichia coli] |
1.94e-78 | 100 | 97.541 | WP_137446478 |
porin [Escherichia coli] Porin OmpN [Escherichia coli] |
2.09e-78 | 100 | 97.541 | WP_112023166 |
porin [Escherichia coli] |
2.09e-78 | 100 | 97.541 | PAB99828 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli P0299917.10] |
2.23e-78 | 100 | 97.541 | WP_001474383 |
porin [Escherichia coli] |
2.23e-78 | 100 | 97.541 | RFA83637 |
MULTISPECIES: porin [Escherichia] |
2.51e-78 | 100 | 96.721 | WP_105290846 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
6.33e-78 | 100 | 96.721 | WP_024222058 |
putative outer membrane protein YedS [Escherichia coli H605] |
7.81e-78 | 100 | 96.721 | OSL48186 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli P0299917.4] |
1.61e-77 | 100 | 96.721 | WP_001478238 |
porin [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] |
2.62e-77 | 100 | 96.721 | WP_053884514 |
porin, partial [Escherichia coli] |
3.49e-73 | 94 | 97.391 | WP_089626238 |
porin, partial [Escherichia coli] |
1.91e-70 | 100 | 90.164 | WP_103742959 |
porin [Escherichia coli] porin [Escherichia coli] |
2.36e-70 | 100 | 90.984 | WP_127673908 |
porin [Escherichia coli] |
3.71e-70 | 100 | 90.984 | WP_097309904 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
3.96e-70 | 100 | 90.984 | WP_069903770 |
porin [Escherichia coli] porin [Escherichia coli] Porin OmpN [Escherichia coli] Porin OmpN [Escherichia coli] outer membrane pore protein [Escherichia coli] outer membrane pore protein [Escherichia coli] |
4.32e-70 | 100 | 90.984 | WP_089567897 |
porin [Escherichia coli] outer membrane protein F [Escherichia coli B354] outer membrane protein S1 [Escherichia coli KTE144] outer membrane porin OmpK36 [Escherichia coli UMEA 3200-1] outer membrane protein N [Escherichia coli 5-366-08_S3_C3] outer membrane protein N [Escherichia coli 5-366-08_S3_C1] porin OmpC [Shigella sonnei] |
4.56e-70 | 100 | 90.984 | WP_000824405 |
MULTISPECIES: porin [Enterobacteriaceae] porin OmpC [Shigella boydii] porin OmpC [Shigella sonnei] porin [Escherichia coli] outer membrane pore protein [Escherichia coli] outer membrane pore protein [Escherichia coli] |
4.71e-70 | 100 | 90.164 | WP_042096248 |
porin OmpC [Escherichia coli] porin [Escherichia coli] |
4.77e-70 | 100 | 90.984 | WP_147696731 |
porin [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] Outer membrane protein N precursor [Escherichia coli] |
4.87e-70 | 100 | 90.984 | WP_029399947 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] outer membrane pore protein [Escherichia coli] |
4.87e-70 | 100 | 90.164 | WP_137536242 |
porin [Escherichia coli] outer membrane protein S1 [Escherichia coli KTE146] |
5.37e-70 | 100 | 90.164 | WP_001602785 |
porin [Escherichia coli] |
5.67e-70 | 100 | 90.984 | WP_097744553 |
porin [Escherichia coli] porin OmpC [Escherichia coli M12] outer membrane protein S1 [Escherichia coli 4_1_47FAA] outer membrane protein S1 [Escherichia coli KTE228] outer membrane protein S1 [Escherichia coli KTE177] outer membrane protein S1 [Escherichia coli KTE231] putative outer membrane protein YedS [Escherichia coli TA249] |
5.67e-70 | 100 | 90.164 | WP_000824406 |
porin [Escherichia coli] porin [Escherichia coli] |
5.67e-70 | 100 | 90.164 | WP_094308272 |
porin [Escherichia coli] putative outer membrane protein YedS [Escherichia coli M056] porin [Escherichia coli] porin [Escherichia coli] |
5.85e-70 | 100 | 90.984 | ORT44495 |
porin [Escherichia coli] porin [Escherichia coli] |
5.92e-70 | 100 | 90.164 | WP_100287050 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
7.04e-70 | 100 | 90.984 | WP_106475183 |
porin, partial [Escherichia coli] Porin OmpN, partial [Escherichia coli 576-1] |
1.02e-69 | 100 | 90.164 | WP_000292494 |
hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein COD49_26655 [Escherichia coli] |
1.2e-69 | 88 | 97.196 | WP_089516167 |
porin [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] |
1.42e-69 | 100 | 90.164 | WP_089571472 |
hypothetical protein [Escherichia coli] |
1.66e-69 | 88 | 97.196 | WP_097512156 |
outer membrane protein F [Escherichia coli] |
1.67e-69 | 87 | 99.057 | STI12259 |
porin [Escherichia coli] Porin OmpN [Escherichia coli] |
1.97e-69 | 100 | 90.164 | WP_112047486 |
porin [Escherichia coli] porin [Escherichia coli] |
2.61e-69 | 100 | 90.164 | WP_096132971 |
porin [Escherichia coli] |
3.17e-69 | 100 | 89.344 | WP_044796203 |
porin [Escherichia coli] outer membrane protein S1 [Escherichia coli KTE213] outer membrane protein S1 [Escherichia coli KTE140] outer membrane protein S1 [Escherichia coli KTE95] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] |
4.49e-69 | 100 | 90.164 | WP_001544644 |
porin [Escherichia coli] |
5.11e-69 | 100 | 90.164 | WP_097514693 |
porin [Escherichia coli] porin [Escherichia coli] |
6.21e-69 | 100 | 90.164 | WP_127448449 |
porin [Escherichia coli] outer membrane protein N [Escherichia coli 2-316-03_S4_C1] |
2.18e-68 | 100 | 89.344 | WP_033871079 |
porin [Escherichia coli] |
2.43e-67 | 87 | 100.000 | WP_089646906 |
porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
2.72e-67 | 88 | 99.065 | WP_000824412 |
porin [Escherichia coli] outer membrane pore protein [Escherichia coli] |
3.15e-67 | 87 | 100.000 | WP_097481425 |
porin [Escherichia coli] porin OmpN [Escherichia coli UMN026] outer membrane protein N [Escherichia coli STEC_C165-02] outer membrane protein S1 [Escherichia coli KTE2] outer membrane protein S1 [Escherichia coli KTE26] outer membrane protein S1 [Escherichia coli KTE181] outer membrane protein S1 [Escherichia coli KTE235] outer membrane protein S1 [Escherichia coli KTE83] outer membrane protein S1 [Escherichia coli KTE116] outer membrane protein S1 [Escherichia coli KTE54] outer membrane protein S1 [Escherichia coli KTE78] outer membrane protein S1 [Escherichia coli KTE79] outer membrane protein S1 [Escherichia coli KTE158] outer membrane protein S1 [Escherichia coli KTE190] outer membrane protein S1 [Escherichia coli KTE105] outer membrane protein S1 [Escherichia coli KTE122] outer membrane protein S1 [Escherichia coli KTE82] outer membrane protein S1 [Escherichia coli KTE200] outer membrane protein S1 [Escherichia coli KTE68] outer membrane protein S1 [Escherichia coli KTE1] outer membrane porin OmpK36 [Escherichia coli HVH 10 (4-6832164)] outer membrane porin OmpK36 [Escherichia coli HVH 22 (4-2258986)] outer membrane porin OmpK36 [Escherichia coli HVH 29 (4-3418073)] outer membrane porin OmpK36 [Escherichia coli HVH 45 (4-3129918)] outer membrane porin OmpK36 [Escherichia coli HVH 63 (4-2542528)] outer membrane porin OmpK36 [Escherichia coli HVH 69 (4-2837072)] outer membrane porin OmpK36 [Escherichia coli HVH 85 (4-0792144)] outer membrane porin OmpK36 [Escherichia coli HVH 88 (4-5854636)] outer membrane porin OmpK36 [Escherichia coli HVH 106 (4-6881831)] outer membrane porin OmpK36 [Escherichia coli HVH 110 (4-6978754)] outer membrane porin OmpK36 [Escherichia coli HVH 119 (4-6879578)] outer membrane porin OmpK36 [Escherichia coli HVH 122 (4-6851606)] outer membrane porin OmpK36 [Escherichia coli HVH 134 (4-6073441)] outer membrane porin OmpK36 [Escherichia coli HVH 135 (4-4449320)] outer membrane porin OmpK36 [Escherichia coli HVH 133 (4-4466519)] outer membrane porin OmpK36 [Escherichia coli HVH 145 (4-5672112)] outer membrane porin OmpK36 [Escherichia coli HVH 151 (4-5755573)] outer membrane porin OmpK36 [Escherichia coli HVH 163 (4-4697553)] outer membrane porin OmpK36 [Escherichia coli HVH 167 (4-6073565)] outer membrane porin OmpK36 [Escherichia coli HVH 173 (3-9175482)] outer membrane porin OmpK36 [Escherichia coli HVH 183 (4-3205932)] outer membrane porin OmpK36 [Escherichia coli HVH 206 (4-3128229)] outer membrane porin OmpK36 [Escherichia coli HVH 208 (4-3112292)] outer membrane porin OmpK36 [Escherichia coli HVH 215 (4-3008371)] outer membrane porin OmpK36 [Escherichia coli KOEGE 68 (182a)] outer membrane porin OmpK36 [Escherichia coli KOEGE 62 (175a)] outer membrane porin OmpK36 [Escherichia coli KOEGE 73 (195a)] outer membrane porin OmpK36 [Escherichia coli HVH 155 (4-4509048)] outer membrane protein N [Escherichia coli 2-005-03_S3_C2] outer membrane protein S1 [Escherichia coli MGH 58] outer membrane protein N [Escherichia coli 2-316-03_S1_C1] outer membrane protein N [Escherichia coli 2-316-03_S1_C2] putative outer membrane protein YedS [Escherichia coli FVEC1465] |
3.4e-67 | 87 | 100.000 | WP_000824409 |
porin [Escherichia coli] |
3.44e-67 | 87 | 100.000 | WP_097336207 |
outer membrane pore protein [Escherichia coli] |
3.78e-67 | 88 | 97.196 | GCZ72925 |
porin [Escherichia coli] porin [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin OmpC [Escherichia coli] porin [Escherichia coli] |
3.96e-67 | 87 | 100.000 | WP_089627256 |
outer membrane protein yedS [Escherichia coli B185] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] porin [Escherichia coli] |
3.99e-67 | 88 | 99.065 | EFF05901 |
MULTISPECIES: porin [Enterobacteriaceae] porin [Escherichia coli] porin [Shigella boydii] porin [Escherichia coli] |
4.18e-67 | 87 | 100.000 | WP_104773811 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_50 In ecoli U00096.3
Seq (len = 122 ):
MTPYGGGEFDNGESRSAIANKTQNFEVVAQYQFDFGLRPSIAYLQSKGKDLGGWAHDGNGDPRYTNKDLVKYVDIGATYYFNKNMSTYVDYKINLLDNDDDFYEANGIATDDIVAVGLVYQF
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|75667|1|2034652-2035240
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
3.674347529427686
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
yjhD [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
yjhD [Escherichia coli] |
1.11e-57 | 100 | 100.000 | STJ67461 |
MULTISPECIES: hypothetical protein [Escherichia] hypothetical protein ECUMN_4843 [Escherichia coli UMN026] hypothetical protein CO715_13420 [Escherichia coli M12] hypothetical protein CXP41_23335 [Escherichia coli str. K-12 substr. MG1655] hypothetical protein CI731_23030 [Shigella sonnei] hypothetical protein CI767_08030 [Shigella boydii] hypothetical protein B5762_04545 [Escherichia coli] |
1.49e-57 | 100 | 100.000 | WP_012602903 |
MULTISPECIES: hypothetical protein [Enterobacteriaceae] hypothetical protein APECO78_02365 [Escherichia coli APEC O78] hypothetical protein EO53_19040 [Escherichia coli str. K-12 substr. MG1655] hypothetical protein SH05_03005 [Escherichia coli K-12] hypothetical protein J444_4668 [Escherichia coli ACN001] hypothetical protein C2566_03090 [Escherichia coli B] hypothetical protein BL257_21795 [Escherichia coli str. K-12 substr. W3110] hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium] hypothetical protein IAE_20603 [Escherichia coli XH140A] hypothetical protein IAM_22623 [Escherichia coli XH001] hypothetical protein EC990741_4916 [Escherichia coli 97.0259] hypothetical protein EC5761_17495 [Escherichia coli 576-1] hypothetical protein C201_22186 [Escherichia coli S17] hypothetical protein MOI_18189 [Escherichia coli P4-NR] hypothetical protein M13_15606 [Escherichia coli P4-96] hypothetical protein L670_20909 [Escherichia coli NCTC 50110] hypothetical protein SU67_17595 [Escherichia coli O139:H28 str. E24377A] hypothetical protein EC970264_4868 [Escherichia coli 97.0264] hypothetical protein [Salmonella enterica subsp. enterica] hypothetical protein [Escherichia coli OP50] hypothetical protein MP34_16545 [Escherichia coli N37122PS] hypothetical protein MP32_18445 [Escherichia coli N36410PS] hypothetical protein EANG_05339 [Escherichia coli FVEC1465] hypothetical protein ECRG_03042 [Escherichia coli H617] hypothetical protein E1A98_21820 [Escherichia coli BW25113] hypothetical protein FYA18_15610 [Escherichia coli O16:H48] hypothetical protein E1179_22205 [Escherichia coli HT115] KpLE2 phage-like element; predicted protein (pseudogene) [Escherichia coli O10:K5(L):H4 str. ATCC 23506] KpLE2 phage-like element; predicted protein (pseudogene) [Klebsiella pneumoniae IS22] Putative uncharacterized protein [Escherichia coli D6-117.29] hypothetical protein [Shigella sp.] |
1.53e-57 | 100 | 100.000 | WP_000254999 |
hypothetical protein C5P17_10115 [Escherichia coli] hypothetical protein C5P13_10225 [Escherichia coli] |
1.54e-57 | 100 | 100.000 | PPW48917 |
hypothetical protein [Escherichia coli] hypothetical protein ECBD_3760 [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] hypothetical protein EcDH1_3719 [Escherichia coli DH1] hypothetical protein HQ24_21995 [Escherichia coli KLY] hypothetical protein ESSG_00190 [Escherichia coli H730] hypothetical protein WCC_04839 [Escherichia coli KTE4] hypothetical protein WCA_00447 [Escherichia coli KTE2] hypothetical protein WEK_04886 [Escherichia coli KTE26] hypothetical protein A139_04354 [Escherichia coli KTE181] hypothetical protein A15I_04576 [Escherichia coli KTE204] hypothetical protein A15K_04758 [Escherichia coli KTE205] hypothetical protein A15Q_04852 [Escherichia coli KTE208] hypothetical protein A17U_03504 [Escherichia coli KTE228] hypothetical protein A1SA_00432 [Escherichia coli KTE51] hypothetical protein A1SK_02342 [Escherichia coli KTE56] hypothetical protein A1UW_04690 [Escherichia coli KTE80] hypothetical protein A1W1_04767 [Escherichia coli KTE83] hypothetical protein WGG_04535 [Escherichia coli KTE43] hypothetical protein A1S9_01467 [Escherichia coli KTE50] hypothetical protein A31C_00434 [Escherichia coli KTE158] hypothetical protein A13Q_00268 [Escherichia coli KTE190] hypothetical protein A15E_00322 [Escherichia coli KTE202] hypothetical protein A17W_03336 [Escherichia coli KTE229] hypothetical protein WI7_04454 [Escherichia coli KTE105] hypothetical protein WII_04685 [Escherichia coli KTE120] hypothetical protein WIK_04709 [Escherichia coli KTE122] hypothetical protein WIO_04584 [Escherichia coli KTE125] hypothetical protein WIQ_04577 [Escherichia coli KTE128] hypothetical protein WIS_04664 [Escherichia coli KTE129] hypothetical protein WKC_04432 [Escherichia coli KTE157] hypothetical protein WKI_04495 [Escherichia coli KTE166] hypothetical protein WKU_04541 [Escherichia coli KTE177] hypothetical protein WKW_04590 [Escherichia coli KTE179] hypothetical protein WGM_04801 [Escherichia coli KTE82] hypothetical protein WGO_04615 [Escherichia coli KTE85] hypothetical protein WAU_00494 [Escherichia coli KTE3] hypothetical protein WC9_04613 [Escherichia coli KTE231] hypothetical protein WGA_04339 [Escherichia coli KTE40] hypothetical protein A15A_04669 [Escherichia coli KTE200] hypothetical protein A17C_04500 [Escherichia coli KTE219] hypothetical protein A157_00319 [Escherichia coli KTE198] hypothetical protein A17I_01735 [Escherichia coli KTE222] hypothetical protein A1U9_04900 [Escherichia coli KTE68] hypothetical protein A1YE_00564 [Escherichia coli KTE127] hypothetical protein A1YK_00171 [Escherichia coli KTE134] hypothetical protein G434_03554 [Escherichia sp. KTE172] hypothetical protein A31O_00388 [Escherichia coli KTE170] hypothetical protein A13A_04928 [Escherichia coli KTE182] hypothetical protein WAS_00451 [Escherichia coli KTE1] hypothetical protein WGC_00367 [Escherichia coli KTE41] hypothetical protein A17O_01056 [Escherichia coli KTE225] hypothetical protein A19A_00220 [Escherichia coli KTE240] hypothetical protein G689_04515 [Escherichia coli HVH 10 (4-6832164)] hypothetical protein G694_04495 [Escherichia coli HVH 18 (4-8589585)] hypothetical protein G695_04622 [Escherichia coli HVH 19 (4-7154984)] hypothetical protein G698_04563 [Escherichia coli HVH 22 (4-2258986)] hypothetical protein G705_04665 [Escherichia coli HVH 29 (4-3418073)] hypothetical protein G718_04522 [Escherichia coli HVH 43 (4-2173468)] hypothetical protein G719_04567 [Escherichia coli HVH 44 (4-2298570)] hypothetical protein G720_04888 [Escherichia coli HVH 45 (4-3129918)] hypothetical protein G730_04585 [Escherichia coli HVH 59 (4-1119338)] hypothetical protein G732_04651 [Escherichia coli HVH 63 (4-2542528)] hypothetical protein G733_04510 [Escherichia coli HVH 65 (4-2262045)] hypothetical protein G735_04552 [Escherichia coli HVH 69 (4-2837072)] hypothetical protein G736_04910 [Escherichia coli HVH 70 (4-2963531)] hypothetical protein G737_04755 [Escherichia coli HVH 73 (4-2393174)] hypothetical protein G747_04385 [Escherichia coli HVH 85 (4-0792144)] hypothetical protein G765_04983 [Escherichia coli HVH 104 (4-6977960)] hypothetical protein G767_04719 [Escherichia coli HVH 106 (4-6881831)] hypothetical protein G771_04908 [Escherichia coli HVH 110 (4-6978754)] hypothetical protein G768_04855 [Escherichia coli HVH 107 (4-5860571)] hypothetical protein G774_04701 [Escherichia coli HVH 113 (4-7535473)] hypothetical protein G781_04724 [Escherichia coli HVH 119 (4-6879578)] hypothetical protein G784_04542 [Escherichia coli HVH 122 (4-6851606)] hypothetical protein G787_04607 [Escherichia coli HVH 127 (4-7303629)] hypothetical protein G788_04747 [Escherichia coli HVH 128 (4-7030436)] hypothetical protein G789_04641 [Escherichia coli HVH 130 (4-7036876)] hypothetical protein G792_04694 [Escherichia coli HVH 134 (4-6073441)] hypothetical protein G793_04615 [Escherichia coli HVH 135 (4-4449320)] hypothetical protein G791_04657 [Escherichia coli HVH 133 (4-4466519)] hypothetical protein G798_04695 [Escherichia coli HVH 140 (4-5894387)] hypothetical protein G803_04847 [Escherichia coli HVH 145 (4-5672112)] hypothetical protein G809_04518 [Escherichia coli HVH 151 (4-5755573)] hypothetical protein G808_04403 [Escherichia coli HVH 150 (4-3258106)] hypothetical protein G821_04790 [Escherichia coli HVH 163 (4-4697553)] hypothetical protein G822_04258 [Escherichia coli HVH 164 (4-5953081)] hypothetical protein G823_04669 [Escherichia coli HVH 167 (4-6073565)] hypothetical protein G828_04677 [Escherichia coli HVH 173 (3-9175482)] hypothetical protein G833_04569 [Escherichia coli HVH 180 (4-3051617)] hypothetical protein G834_04565 [Escherichia coli HVH 182 (4-0985554)] hypothetical protein G835_04821 [Escherichia coli HVH 183 (4-3205932)] hypothetical protein G841_04520 [Escherichia coli HVH 189 (4-3220125)] hypothetical protein G858_04699 [Escherichia coli HVH 206 (4-3128229)] hypothetical protein G860_04783 [Escherichia coli HVH 208 (4-3112292)] hypothetical protein G865_04913 [Escherichia coli HVH 213 (4-3042928)] hypothetical protein G867_04776 [Escherichia coli HVH 215 (4-3008371)] hypothetical protein G873_04475 [Escherichia coli HVH 222 (4-2977443)] hypothetical protein G874_04700 [Escherichia coli HVH 223 (4-2976528)] hypothetical protein G875_04651 [Escherichia coli HVH 225 (4-1273116)] hypothetical protein G882_04525 [Escherichia coli KOEGE 32 (66a)] hypothetical protein G883_04435 [Escherichia coli KOEGE 33 (68a)] hypothetical protein G891_04528 [Escherichia coli KOEGE 68 (182a)] hypothetical protein G890_04899 [Escherichia coli KOEGE 62 (175a)] hypothetical protein G894_04381 [Escherichia coli KOEGE 73 (195a)] hypothetical protein G895_04708 [Escherichia coli KOEGE 77 (202a)] hypothetical protein G901_04505 [Escherichia coli UMEA 3041-1] hypothetical protein G906_05029 [Escherichia coli UMEA 3088-1] hypothetical protein G915_02472 [Escherichia coli UMEA 3140-1] hypothetical protein G929_04646 [Escherichia coli UMEA 3174-1] hypothetical protein G939_03732 [Escherichia coli UMEA 3201-1] hypothetical protein G944_04744 [Escherichia coli UMEA 3215-1] hypothetical protein G967_04526 [Escherichia coli UMEA 3329-1] hypothetical protein G972_04626 [Escherichia coli UMEA 3355-1] hypothetical protein G978_04586 [Escherichia coli UMEA 3592-1] hypothetical protein G979_04757 [Escherichia coli UMEA 3609-1] hypothetical protein G813_04667 [Escherichia coli HVH 155 (4-4509048)] hypothetical protein G916_04514 [Escherichia coli UMEA 3144-1] hypothetical protein L454_04664 [Escherichia coli BIDMC 19C] hypothetical protein G711_01390 [Escherichia coli HVH 36 (4-5675286)] hypothetical protein G794_04597 [Escherichia coli HVH 136 (4-5970458)] hypothetical protein G690_04366 [Escherichia coli HVH 12 (4-7653042)] hypothetical protein G832_04551 [Escherichia coli HVH 178 (4-3189163)] hypothetical protein G806_01349 [Escherichia coli HVH 148 (4-3192490)] hypothetical protein P804_03212 [Escherichia coli BIDMC 43b] hypothetical protein P803_04551 [Escherichia coli BIDMC 43a] hypothetical protein L453_08951 [Escherichia coli BIDMC 19B] hypothetical protein L452_05316 [Escherichia coli BIDMC 19A] hypothetical protein L446_08952 [Escherichia coli BIDMC 17A] hypothetical protein L447_04650 [Escherichia coli BIDMC 17B] hypothetical protein L444_09064 [Escherichia coli BIDMC 15] hypothetical protein L436_08884 [Escherichia coli BIDMC 9] hypothetical protein L429_09195 [Escherichia coli BIDMC 3] hypothetical protein L428_08870 [Escherichia coli BIDMC 2B] hypothetical protein L408_00357 [Escherichia coli BWH 40] hypothetical protein P811_03212 [Escherichia coli BIDMC 49b] hypothetical protein P810_03215 [Escherichia coli BIDMC 49a] hypothetical protein L432_08880 [Escherichia coli BIDMC 6] hypothetical protein AF55_05077 [Escherichia coli BIDMC 82] hypothetical protein AE47_03819 [Escherichia coli BIDMC 72] hypothetical protein AE48_04639 [Escherichia coli BIDMC 73] hypothetical protein AE52_03170 [Escherichia coli BIDMC 77] hypothetical protein AF44_03397 [Escherichia coli MGH 58] hypothetical protein EP55_18050 [Escherichia coli N37139PS] hypothetical protein KRX_4171 [Escherichia coli KRX] Uncharacterised protein [Klebsiella pneumoniae] |
1.55e-57 | 100 | 100.000 | WP_001405511 |
ORF_f124 [Escherichia coli str. K-12 substr. MG1655] unknown [Escherichia coli] hypothetical protein P12B_c4384 [Escherichia coli P12b] yjhD protein [Escherichia coli FVEC1412] yjhD protein [Escherichia coli FVEC1302] hypothetical protein HMPREF9552_01377 [Escherichia coli MS 198-1] hypothetical protein HMPREF9543_04515 [Escherichia coli MS 146-1] hypothetical protein HMPREF1588_01960 [Escherichia coli 110957] hypothetical protein HMPREF1599_00678 [Escherichia coli 907713] hypothetical protein HMPREF1600_00636 [Escherichia coli 907715] hypothetical protein HMPREF1605_00335 [Escherichia coli 908521] hypothetical protein HMPREF1613_00142 [Escherichia coli 908616] hypothetical protein HMPREF1612_00128 [Escherichia coli 908585] hypothetical protein HMPREF1617_00627 [Escherichia coli 908675] hypothetical protein BN16_03151 [Escherichia coli chi7122] |
1.62e-57 | 100 | 100.000 | AAA97177 |
hypothetical protein [Escherichia coli] |
5.01e-57 | 100 | 98.824 | WP_032171671 |
hypothetical protein G750_04470 [Escherichia coli HVH 88 (4-5854636)] |
5.53e-57 | 100 | 98.824 | EQP99147 |
hypothetical protein [Escherichia coli] hypothetical protein LS43_24865 [Escherichia coli] |
5.72e-57 | 100 | 98.824 | WP_042631132 |
hypothetical protein [Escherichia coli] |
5.97e-57 | 100 | 98.824 | WP_032147325 |
hypothetical protein CNQ48_22040 [Escherichia coli] |
6.02e-57 | 100 | 98.824 | ATC14321 |
hypothetical protein HmCmsJML217_02303 [Escherichia coli] |
1.03e-56 | 100 | 98.824 | GDD73651 |
hypothetical protein B6V57_25030 [Escherichia coli] |
1.19e-56 | 100 | 98.824 | AWG09521 |
hypothetical protein [Escherichia coli] hypothetical protein BFQ27_21220 [Escherichia coli] |
1.19e-56 | 100 | 98.824 | WP_139371296 |
hypothetical protein [Escherichia coli] |
1.35e-56 | 100 | 98.824 | WP_033885752 |
MULTISPECIES: hypothetical protein [Escherichia] hypothetical protein G846_01571 [Escherichia coli HVH 194 (4-2356805)] hypothetical protein [Escherichia coli] hypothetical protein BMT62_06900 [Escherichia coli] hypothetical protein B7D90_10540 [Escherichia coli] hypothetical protein BMR62_07935 [Escherichia coli] |
1.41e-56 | 100 | 98.824 | WP_000255000 |
hypothetical protein HmCms191_05087 [Escherichia coli] |
1.42e-56 | 99 | 100.000 | GCT45229 |
hypothetical protein ESRG_01637 [Escherichia coli TA124] |
1.59e-56 | 100 | 98.824 | EHN87339 |
hypothetical protein [Escherichia coli] |
1.66e-56 | 100 | 98.824 | WP_115189171 |
hypothetical protein [Escherichia coli] |
1.68e-56 | 99 | 100.000 | WP_137485422 |
yjhD [Escherichia coli] |
1.75e-56 | 100 | 98.824 | STG31774 |
hypothetical protein A317_02378 [Escherichia coli KTE154] |
1.91e-56 | 100 | 98.824 | ELG98202 |
hypothetical protein [Escherichia coli] hypothetical protein AM346_21610 [Escherichia coli] hypothetical protein CDL49_10845 [Escherichia coli] hypothetical protein BMR57_19595 [Escherichia coli] hypothetical protein C6954_23545 [Escherichia coli] |
2.45e-56 | 100 | 98.824 | WP_077628167 |
hypothetical protein SK81_03923 [Escherichia coli] hypothetical protein RIKO2299_86c00550 [Escherichia coli] Uncharacterised protein [Escherichia coli] hypothetical protein BANRA_02617 [Escherichia coli] hypothetical protein BANRA_00243 [Escherichia coli] |
2.84e-56 | 100 | 98.824 | KLX72850 |
hypothetical protein HMPREF9348_00072 [Escherichia coli MS 145-7] |
2.91e-56 | 100 | 98.824 | EFO60471 |
hypothetical protein [Escherichia coli] hypothetical protein EKS36_07925 [Shigella sonnei] hypothetical protein A8V37_22300 [Escherichia coli] hypothetical protein C6669_05940 [Escherichia coli] hypothetical protein F6X71_11015 [Escherichia coli] hypothetical protein BHL56_15465 [Escherichia coli] |
3.74e-56 | 100 | 98.824 | WP_000254998 |
MULTISPECIES: hypothetical protein [Escherichia] hypothetical protein CI685_07360 [Shigella sonnei] hypothetical protein CNQ56_22505 [Escherichia coli] hypothetical protein BWI87_06190 [Escherichia coli] hypothetical protein CY655_26910 [Escherichia coli] hypothetical protein B8A27_16350 [Escherichia coli] |
6.8e-56 | 100 | 97.647 | WP_077250776 |
MULTISPECIES: hypothetical protein [Enterobacteriaceae] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica subsp. enterica serovar Tennessee] hypothetical protein DP32_25170 [Escherichia coli] KpLE2 phage-like element [Escherichia coli] hypothetical protein AM340_02885 [Escherichia coli] |
7.15e-56 | 100 | 97.647 | WP_000255001 |
hypothetical protein G725_04846 [Escherichia coli HVH 53 (4-0631051)] hypothetical protein G839_03912 [Escherichia coli HVH 187 (4-4471660)] hypothetical protein G923_04636 [Escherichia coli UMEA 3160-1] hypothetical protein G995_03942 [Escherichia coli UMEA 3805-1] hypothetical protein H000_03609 [Escherichia coli UMEA 3899-1] hypothetical protein C4A43_00030 [Escherichia coli] |
8.42e-56 | 100 | 97.647 | EQO92127 |
hypothetical protein [Escherichia coli] |
1.94e-55 | 100 | 97.647 | WP_134889231 |
MULTISPECIES: hypothetical protein [Bacteria] hypothetical protein EQH62_06225 [Escherichia coli] hypothetical protein FSZ06_09670 [Enterococcus gallinarum] KpLE2 phage-like element; predicted protein (pseudogene) [Escherichia coli IS1] |
2.22e-55 | 100 | 96.471 | WP_032158690 |
yjhD [Escherichia coli] |
2.49e-55 | 100 | 97.647 | STH08054 |
hypothetical protein A1YO_00293 [Escherichia coli KTE136] hypothetical protein EC2772a_65c01330 [Escherichia coli] hypothetical protein AZZ88_002885 [Escherichia coli] hypothetical protein BvCmsNSNP010_01083 [Escherichia coli] yjhD [Escherichia coli] |
2.72e-55 | 100 | 96.471 | ELG73863 |
hypothetical protein RX06_04257 [Escherichia coli] |
3.66e-55 | 100 | 96.471 | OYB47458 |
hypothetical protein [Escherichia coli] hypothetical protein GP717_15765 [Escherichia coli] hypothetical protein GP663_16040 [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein BHF16_12080 [Escherichia coli] |
3.79e-55 | 100 | 96.471 | WP_069913357 |
hypothetical protein [Escherichia coli] |
5.57e-55 | 100 | 96.471 | EAA2068352 |
hypothetical protein [Escherichia coli] |
6.61e-55 | 96 | 100.000 | WP_151404023 |
hypothetical protein CHI19_06175 [Escherichia coli] |
8.09e-55 | 96 | 100.000 | AXV11155 |
hypothetical protein, partial [Escherichia coli] hypothetical protein DTD87_26305, partial [Escherichia coli] |
4.17e-52 | 93 | 100.000 | WP_114493579 |
hypothetical protein, partial [Escherichia coli] |
1.15e-50 | 91 | 100.000 | WP_141087069 |
PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein YjhD [Escherichia coli K-12] hypothetical protein BWL12_23745 [Escherichia coli] hypothetical protein ERKG_02983 [Escherichia coli H252] hypothetical protein ERFG_03598 [Escherichia coli TW10509] yjhD protein [Escherichia coli DEC1A] yjhD protein [Escherichia coli DEC1B] yjhD protein [Escherichia coli DEC1C] yjhD protein [Escherichia coli DEC1E] yjhD protein [Escherichia coli DEC2B] yjhD [Escherichia coli DEC2A] yjhD protein [Escherichia coli DEC2C] yjhD protein [Escherichia coli DEC2D] yjhD protein [Escherichia coli DEC2E] hypothetical protein OQE_39840 [Escherichia coli J53] putative yjhD [Escherichia coli 1-110-08_S1_C3] putative yjhD [Escherichia coli 1-110-08_S1_C1] putative yjhD [Escherichia coli 1-250-04_S4_C2] putative yjhD [Escherichia coli 1-250-04_S4_C1] putative yjhD [Escherichia coli 1-182-04_S3_C2] putative yjhD [Escherichia coli 1-182-04_S3_C3] putative yjhD [Escherichia coli 1-182-04_S3_C1] putative yjhD [Escherichia coli 1-182-04_S1_C3] putative yjhD [Escherichia coli 1-182-04_S1_C1] putative yjhD [Escherichia coli 1-182-04_S1_C2] putative yjhD [Escherichia coli 2-005-03_S3_C2] putative yjhD [Escherichia coli 2-222-05_S3_C3] putative yjhD [Escherichia coli 2-316-03_S4_C1] putative yjhD [Escherichia coli 2-316-03_S4_C3] putative yjhD [Escherichia coli 2-316-03_S1_C1] putative yjhD [Escherichia coli 2-316-03_S1_C2] putative yjhD [Escherichia coli 3-020-07_S4_C1] putative yjhD [Escherichia coli 3-475-03_S1_C2] putative yjhD [Escherichia coli 5-172-05_S3_C3] putative yjhD [Escherichia coli 2-222-05_S3_C1] putative yjhD [Escherichia coli 2-222-05_S3_C2] yjhD [Escherichia coli BL21(DE3)] |
1.36e-50 | 89 | 98.684 | P39354 |
putative yjhD [Escherichia coli 2-005-03_S1_C3] putative yjhD [Escherichia coli 2-005-03_S1_C2] putative yjhD [Escherichia coli 2-005-03_S1_C1] putative yjhD [Escherichia coli 2-052-05_S1_C1] putative yjhD [Escherichia coli 2-052-05_S1_C3] putative yjhD [Escherichia coli 2-177-06_S1_C1] putative yjhD [Escherichia coli 2-177-06_S1_C3] putative yjhD [Escherichia coli 2-177-06_S1_C2] |
4.59e-50 | 89 | 97.368 | EZK08059 |
hypothetical protein, partial [Escherichia coli] |
5.66e-50 | 93 | 96.203 | WP_123009402 |
hypothetical protein [Escherichia coli] hypothetical protein ECIAI39_4749 [Escherichia coli IAI39] hypothetical protein ECDEC14A_4749 [Escherichia coli DEC14A] putative yjhD [Escherichia coli 2-427-07_S4_C3] putative yjhD [Escherichia coli 3-267-03_S4_C1] putative yjhD [Escherichia coli 1-392-07_S4_C3] putative yjhD [Escherichia coli 1-392-07_S4_C1] putative yjhD [Escherichia coli 2-460-02_S1_C1] hypothetical protein ETEC_4616 [Escherichia coli ETEC H10407] |
6.7e-49 | 89 | 96.053 | WP_001439292 |
hypothetical protein, partial [Escherichia coli] hypothetical protein D9K55_28735, partial [Escherichia coli] |
1.65e-48 | 88 | 100.000 | WP_128999403 |
hypothetical protein [Escherichia coli] hypothetical protein ELX66_23675 [Escherichia coli] |
2.74e-48 | 100 | 88.235 | WP_135155417 |
hypothetical protein HmCms163_00788 [Escherichia coli] |
1.61e-47 | 100 | 87.059 | GCU08382 |
hypothetical protein HMPREF9553_00141 [Escherichia coli MS 200-1] hypothetical protein ECNC101_09179 [Escherichia coli NC101] |
2.11e-47 | 96 | 90.244 | EFJ63710 |
hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] |
2.13e-47 | 100 | 88.235 | WP_113854165 |
MULTISPECIES: hypothetical protein [Enterobacteriaceae] hypothetical protein WCY_03912 [Escherichia coli KTE16] hypothetical protein A137_03749 [Escherichia coli KTE178] hypothetical protein A15M_04611 [Escherichia coli KTE206] hypothetical protein A17M_03148 [Escherichia coli KTE224] hypothetical protein A1WE_03264 [Escherichia coli KTE93] hypothetical protein A31M_03166 [Escherichia coli KTE169] hypothetical protein WCI_03105 [Escherichia coli KTE8] hypothetical protein A13Y_03488 [Escherichia coli KTE194] hypothetical protein A15O_03734 [Escherichia coli KTE207] hypothetical protein A175_03203 [Escherichia coli KTE215] hypothetical protein WIE_04633 [Escherichia coli KTE113] hypothetical protein WIU_04454 [Escherichia coli KTE131] hypothetical protein WIW_04486 [Escherichia coli KTE133] hypothetical protein WK5_04536 [Escherichia coli KTE145] hypothetical protein WKO_04571 [Escherichia coli KTE168] hypothetical protein G693_03113 [Escherichia coli HVH 17 (4-7473087)] hypothetical protein G704_03059 [Escherichia coli HVH 28 (4-0907367)] hypothetical protein G713_03071 [Escherichia coli HVH 38 (4-2774682)] hypothetical protein G714_00294 [Escherichia coli HVH 39 (4-2679949)] hypothetical protein G728_04574 [Escherichia coli HVH 56 (4-2153033)] hypothetical protein G773_04741 [Escherichia coli HVH 112 (4-5987253)] hypothetical protein G799_03181 [Escherichia coli HVH 141 (4-5995973)] hypothetical protein G804_03194 [Escherichia coli HVH 146 (4-3189767)] hypothetical protein G837_03055 [Escherichia coli HVH 185 (4-2876639)] hypothetical protein G881_04874 [Escherichia coli KOEGE 30 (63a)] hypothetical protein G888_02955 [Escherichia coli KOEGE 58 (171a)] hypothetical protein G892_02999 [Escherichia coli KOEGE 70 (185a)] hypothetical protein G899_03047 [Escherichia coli UMEA 3022-1] hypothetical protein G907_02868 [Escherichia coli UMEA 3097-1] hypothetical protein G909_03033 [Escherichia coli UMEA 3113-1] hypothetical protein G946_03009 [Escherichia coli UMEA 3217-1] hypothetical protein G970_03006 [Escherichia coli UMEA 3341-1] hypothetical protein G973_03141 [Escherichia coli UMEA 3391-1] hypothetical protein G980_02958 [Escherichia coli UMEA 3617-1] hypothetical protein G959_03010 [Escherichia coli UMEA 3290-1] hypothetical protein EAQG_00068 [Escherichia coli TA464] hypothetical protein FYA20_07885 [Escherichia coli O2:H6] |
3.09e-47 | 96 | 90.244 | WP_001520155 |
hypothetical protein [Escherichia coli] |
5.24e-47 | 100 | 87.059 | MPQ88812 |
hypothetical protein G991_04468 [Escherichia coli UMEA 3703-1] hypothetical protein BvCmsB15A_04705 [Escherichia coli] hypothetical protein ExPECSC057_00973 [Escherichia coli] hypothetical protein HmCmsJML144_01665 [Escherichia coli] hypothetical protein HmCmsJML183_00353 [Escherichia coli] |
1.06e-46 | 100 | 87.059 | EQZ85149 |
hypothetical protein [Escherichia coli] |
1.2e-46 | 86 | 100.000 | MXE65948 |
hypothetical protein [Escherichia coli] hypothetical protein EAAG_03969 [Escherichia coli H001] hypothetical protein A8M61_13225 [Escherichia coli] hypothetical protein C4M78_05040 [Escherichia coli] hypothetical protein BON78_13910 [Escherichia coli] hypothetical protein BON79_11630 [Escherichia coli] |
1.26e-46 | 100 | 87.059 | WP_032152063 |
hypothetical protein [Escherichia coli] hypothetical protein BEJ62_05915 [Escherichia coli] |
2.84e-46 | 100 | 87.059 | WP_113402677 |
hypothetical protein [Escherichia coli] |
3.13e-46 | 96 | 89.024 | WP_152836983 |
hypothetical protein ExPECSC028_04384 [Escherichia coli] yjhD [Escherichia coli] |
1.2e-45 | 100 | 85.882 | GCP26591 |
hypothetical protein A8M69_21155 [Escherichia coli] |
1.66e-45 | 100 | 85.882 | OWE77252 |
hypothetical protein RG32_13985 [Escherichia coli] hypothetical protein RG33_00160 [Escherichia coli] hypothetical protein DO98_17930 [Escherichia coli] hypothetical protein GT41_24165 [Escherichia coli] hypothetical protein EABG_05059 [Escherichia coli H223] |
5.57e-45 | 89 | 92.105 | APJ91947 |
hypothetical protein [Citrobacter amalonaticus] |
6.82e-44 | 100 | 81.176 | WP_080950080 |
hypothetical protein F384_16620 [Citrobacter amalonaticus Y19] |
1.36e-43 | 100 | 81.176 | AKE61974 |
yjhD [Escherichia coli] |
5.72e-43 | 89 | 92.105 | STJ13710 |
hypothetical protein, partial [Escherichia coli] |
1.02e-42 | 80 | 100.000 | WP_140429342 |
hypothetical protein [Citrobacter farmeri] hypothetical protein EGK65_17760 [Citrobacter farmeri] |
1.48e-42 | 100 | 80.000 | WP_125369851 |
hypothetical protein B7952_22445, partial [Escherichia coli] |
2.55e-42 | 80 | 100.000 | PAQ20198 |
hypothetical protein DTD87_25995, partial [Escherichia coli] |
7.48e-42 | 93 | 86.076 | RCO58438 |
hypothetical protein [Salmonella enterica subsp. enterica serovar Oranienburg] |
4.55e-41 | 75 | 100.000 | EBV7054839 |
putative yjhD [Escherichia coli 3-073-06_S1_C2] putative yjhD [Escherichia coli 5-366-08_S4_C1] |
1.95e-37 | 75 | 95.312 | KDZ57414 |
putative yjhD [Escherichia coli 3-105-05_S3_C1] putative yjhD [Escherichia coli 3-105-05_S3_C2] putative yjhD [Escherichia coli 2-427-07_S4_C1] |
2.87e-36 | 75 | 93.750 | KDT32616 |
hypothetical protein G880_04754 [Escherichia coli KOEGE 10 (25a)] yjhD [Escherichia coli] yjhD [Escherichia coli] yjhD [Escherichia coli] yjhD [Escherichia coli] |
4.07e-36 | 75 | 93.750 | ERA99275 |
hypothetical protein, partial [Escherichia coli] |
1.18e-35 | 69 | 100.000 | WP_115725204 |
hypothetical protein [Escherichia coli] |
5.51e-35 | 69 | 96.610 | MGR19006 |
hypothetical protein, partial [Escherichia coli] |
7.16e-35 | 69 | 96.610 | WP_114042847 |
hypothetical protein, partial [Escherichia coli] |
9.4e-34 | 67 | 98.246 | WP_114142971 |
MULTISPECIES: hypothetical protein [Mangrovibacter] |
2.26e-29 | 100 | 60.000 | WP_084172274 |
hypothetical protein [Dickeya zeae] hypothetical protein C1O30_05115 [Dickeya zeae] |
8.75e-29 | 96 | 57.317 | WP_102801220 |
surface-adhesin protein E [Mangrovibacter plantisponsor] |
9.09e-29 | 100 | 60.000 | PWW10044 |
hypothetical protein [Dickeya zeae] |
9.55e-29 | 96 | 57.317 | WP_038915706 |
hypothetical protein DT73_10915 [Mangrovibacter sp. MFB070] |
1.02e-28 | 100 | 60.000 | KEA52609 |
hypothetical protein [Escherichia coli] |
5.52e-28 | 60 | 96.078 | MXD28222 |
hypothetical protein [Dickeya chrysanthemi] |
2.3e-27 | 96 | 57.317 | WP_152486934 |
hypothetical protein [Pantoea sp. LMG 27579] |
3.92e-27 | 100 | 54.118 | WP_128175020 |
hypothetical protein [Mangrovibacter phragmitis] |
4.26e-27 | 94 | 61.250 | WP_074388840 |
hypothetical protein ED28_00025 [Pantoea sp. LMG 27579] |
1.32e-26 | 100 | 54.118 | RWR03410 |
hypothetical protein [Pantoea sp. 201603H] |
1.16e-25 | 100 | 52.941 | WP_154324994 |
hypothetical protein AO703_00320 [[Enterobacter] lignolyticus] |
1.78e-25 | 100 | 54.118 | ALR78822 |
hypothetical protein [[Enterobacter] lignolyticus] |
2.06e-24 | 100 | 54.118 | WP_071841436 |
putative lipoprotein [[Enterobacter] lignolyticus SCF1] |
2.12e-24 | 100 | 54.118 | ADO50536 |
surface-adhesin protein E [Enterobacter sp. AG5470] Surface-adhesin protein E [Kosakonia oryzendophytica] |
3.3e-24 | 98 | 54.217 | TDT57038 |
hypothetical protein [Kosakonia oryzendophytica] |
5.23e-24 | 98 | 54.217 | WP_088237831 |
hypothetical protein [Enterobacter sp. FY-07] Lipoprotein, putative [Enterobacter sp. FY-07] |
5.4e-24 | 98 | 54.217 | WP_082794132 |
MULTISPECIES: hypothetical protein [Pectobacterium] hypothetical protein EIP93_11755 [Pectobacterium carotovorum] hypothetical protein F131LOC_03315 [Pectobacterium versatile] hypothetical protein F018LOC_00412 [Pectobacterium versatile] hypothetical protein EG330_18100 [Pectobacterium versatile] hypothetical protein EG333_03195 [Pectobacterium versatile] |
4.78e-19 | 96 | 47.561 | WP_103940291 |
hypothetical protein [Pectobacterium parmentieri] putative lipoprotein [Pectobacterium parmentieri WPP163] Lipoprotein, putative [Pectobacterium parmentieri] hypothetical protein A8F97_06555 [Pectobacterium parmentieri] hypothetical protein C5E26_12095 [Pectobacterium parmentieri] hypothetical protein C5E25_11270 [Pectobacterium parmentieri] |
1.18e-18 | 96 | 47.561 | WP_014700058 |
hypothetical protein KP17_01740 [Pectobacterium polaris] hypothetical protein RC88_01850 [Pectobacterium polaris] |
2.49e-18 | 96 | 46.341 | KFX18774 |
MULTISPECIES: hypothetical protein [Pectobacterium] |
2.67e-18 | 96 | 46.341 | WP_052012009 |
hypothetical protein [Pectobacterium polaris] hypothetical protein BJJ97_15910 [Pectobacterium polaris] |
3.35e-18 | 96 | 46.341 | WP_095994610 |
hypothetical protein [Pectobacterium polonicum] hypothetical protein EDI29_03330 [Pectobacterium polonicum] |
5.69e-18 | 96 | 46.341 | WP_137739706 |
hypothetical protein AYL25_09500 [Enterobacter roggenkampii] |
3.97e-17 | 95 | 45.679 | OBS89190 |
hypothetical protein [Pantoea sp.] |
4.06e-17 | 93 | 49.367 | HAB24865 |
hypothetical protein [Franconibacter pulveris] hypothetical protein ACH50_13065 [Franconibacter pulveris] |
4.31e-17 | 87 | 50.000 | WP_029697660 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_51 In blautia CP039126.1
Seq (len = 26 ):
IYLSESAGTVDCAADTVGGDRDLCTG
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|13261|1|341831-341909
Transkriptom
97.0% of gene length expressed over median expression of contig.
ŝ
2.092767840582156
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
adenylate kinase [Listeria monocytogenes]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein DXD84_08785 [Dorea formicigenerans] hypothetical protein DXD82_07960 [Dorea formicigenerans] hypothetical protein DXD10_07785 [Dorea formicigenerans] hypothetical protein DXA18_00450 [Dorea sp. AM58-8] |
8.12e-17 | 100 | 51.515 | RGI83974 |
hypothetical protein RHS_2641 [Robinsoniella sp. RHS] |
1.62e-11 | 100 | 40.909 | KLU71569 |
hypothetical protein [Faecalicatena contorta] hypothetical protein A8805_10711 [Faecalicatena contorta] hypothetical protein SAMN05216529_10711 [Faecalicatena contorta] |
3.45e-11 | 100 | 39.394 | WP_109711570 |
hypothetical protein [Eubacterium sp. TM05-53] hypothetical protein DXD51_10490 [Eubacterium sp. TM05-53] |
9.05e-11 | 68 | 55.556 | WP_117572997 |
Uncharacterised protein [uncultured Ruminococcus sp.] |
2.64e-09 | 97 | 35.938 | SCJ49170 |
Uncharacterised protein [uncultured Ruminococcus sp.] |
2.91e-09 | 97 | 35.938 | SCH75107 |
hypothetical protein HMPREF0863_02444 [Erysipelotrichaceae bacterium 5_2_54FAA] |
1.56e-08 | 97 | 43.284 | EFE45523 |
hypothetical protein [Lactococcus lactis] hypothetical protein BW155_05210 [Lactococcus lactis subsp. lactis] |
2.4e-08 | 97 | 37.500 | WP_098407845 |
hypothetical protein [[Ruminococcus] gnavus] |
3.68e-08 | 97 | 35.938 | WP_144362397 |
hypothetical protein [Lactococcus piscium] Uncharacterized protein LACPI_1970 [Lactococcus piscium MKFS47] |
4.01e-08 | 80 | 43.396 | WP_047916174 |
hypothetical protein [Lactococcus lactis] prophage protein [Lactococcus lactis subsp. lactis] hypothetical protein UC317_2131 [Lactococcus lactis subsp. lactis] hypothetical protein LLA03_23300 [Lactococcus lactis subsp. lactis] |
1.12e-07 | 97 | 35.938 | WP_058225920 |
hypothetical protein [Lactococcus lactis] hypothetical protein BW154_02800 [Lactococcus lactis] |
1.16e-07 | 97 | 35.938 | WP_098393220 |
hypothetical protein [Bacillus thuringiensis] hypothetical protein CN486_30960 [Bacillus thuringiensis] hypothetical protein CN929_12275 [Bacillus thuringiensis] |
2.64e-07 | 95 | 37.681 | WP_098313007 |
hypothetical protein [Beduini massiliensis] |
1.81e-06 | 94 | 33.871 | WP_041137874 |
MULTISPECIES: hypothetical protein [unclassified Ruminococcus] |
2.23e-06 | 92 | 36.066 | WP_147324760 |
hypothetical protein [Listeria monocytogenes] |
2.3e-06 | 82 | 38.889 | EAG7074006 |
adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] |
2.93e-06 | 94 | 37.879 | EAE4372894 |
hypothetical protein [Lactococcus chungangensis] hypothetical protein RR45_GL000727 [Lactococcus chungangensis CAU 28 = DSM 22330] hypothetical protein SAMN02746068_00720 [Lactococcus chungangensis CAU 28 = DSM 22330] |
3.31e-06 | 80 | 35.849 | WP_031365317 |
adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] |
4.69e-06 | 82 | 41.379 | HAA4028707 |
adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] |
5.41e-06 | 82 | 41.379 | EAC6449899 |
hypothetical protein [Bacillus horikoshii] hypothetical protein FZC76_15955 [Bacillus horikoshii] |
5.53e-06 | 95 | 36.923 | WP_148989163 |
hypothetical protein [Lactobacillus paracasei] hypothetical protein DMC16_12890 [Lactobacillus paracasei] |
5.58e-06 | 79 | 43.396 | WP_032790936 |
adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] |
5.84e-06 | 82 | 41.379 | EAC3871248 |
MULTISPECIES: hypothetical protein [Listeria] adenylate kinase [Listeria monocytogenes CFSAN003825] adenylate kinase [Listeria monocytogenes CFSAN003824] adenylate kinase [Listeria monocytogenes CFSAN003811] Adenylate kinase [Listeria monocytogenes Lm_1823] Adenylate kinase [Listeria monocytogenes Lm_1880] Adenylate kinase [Listeria monocytogenes Lm_1889] hypothetical protein T283_13955 [Listeria monocytogenes N53-1] Gp41-1 [Listeria monocytogenes 6179] Gp41-1 [Listeria monocytogenes 4423] |
6.1e-06 | 82 | 41.379 | WP_015455157 |
hypothetical protein [Listeria monocytogenes] gp41-1 [Listeria phage A118] adenylate kinase [Listeria innocua] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] adenylate kinase [Listeria monocytogenes] |
6.24e-06 | 82 | 41.379 | WP_015967160 |
MULTISPECIES: hypothetical protein [Bacillus] hypothetical protein CWS20_11890 [Bacillus horneckiae] |
6.48e-06 | 91 | 39.394 | WP_066192260 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_52 In anaero CP036345.1
Seq (len = 33 ):
ILSSAFIGVKIGVIIPFSSTFFMMRSPFNFEFL
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|131403|1|3441021-3441207
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.256751622268268
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_53 In blautia CP039126.1
Seq (len = 13 ):
ISVPEGAAALFPI
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|19149|1|496057-496228
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8396315252071516
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_54 In blautia CP039126.1
Seq (len = 46 ):
MEDNMTDKQFKTILEMFGMILDGCKDLEEAKKKVEKLLEEQKNKSE
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|406328|-1|1268009-1268180
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
7.192285293268079
unique PSMS
6
unique PSMS
6
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Blautia producta] |
1.76e-22 | 100 | 100.000 | WP_018597921 |
hypothetical protein [Clostridiales bacterium VE202-06] |
3.44e-22 | 100 | 97.826 | WP_155857321 |
hypothetical protein EV205_101155 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
7.34e-22 | 100 | 97.826 | TCO67169 |
hypothetical protein PMF13cell1_04453 [Blautia producta] |
8.38e-22 | 100 | 97.826 | QBE98884 |
MULTISPECIES: hypothetical protein [Lachnoclostridium] |
3.79e-11 | 91 | 73.810 | WP_157127772 |
hypothetical protein [[Eubacterium] eligens] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] |
1.21e-10 | 91 | 71.429 | WP_154268336 |
hypothetical protein [Anaerotruncus sp. 1XD22-93] |
2.44e-09 | 98 | 62.222 | WP_158605034 |
hypothetical protein [Firmicutes bacterium ASF500] hypothetical protein N510_01368 [Firmicutes bacterium ASF500] |
5.47e-08 | 96 | 54.545 | WP_023347089 |
hypothetical protein [Anaerotruncus sp. 1XD22-93] |
3.42e-07 | 91 | 61.905 | WP_158604876 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_55 In blautia CP039126.1
Seq (len = 46 ):
MEDNMTDKQFKTILEMFGMILDGCKDLEEAKKKVEKLLEEQKNKSE
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|382198|-1|1986304-1986475
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
7.192285293268079
unique PSMS
6
unique PSMS
6
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Blautia producta] |
1.76e-22 | 100 | 100.000 | WP_018597921 |
hypothetical protein [Clostridiales bacterium VE202-06] |
3.44e-22 | 100 | 97.826 | WP_155857321 |
hypothetical protein EV205_101155 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
7.34e-22 | 100 | 97.826 | TCO67169 |
hypothetical protein PMF13cell1_04453 [Blautia producta] |
8.38e-22 | 100 | 97.826 | QBE98884 |
MULTISPECIES: hypothetical protein [Lachnoclostridium] |
3.79e-11 | 91 | 73.810 | WP_157127772 |
hypothetical protein [[Eubacterium] eligens] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] |
1.21e-10 | 91 | 71.429 | WP_154268336 |
hypothetical protein [Anaerotruncus sp. 1XD22-93] |
2.44e-09 | 98 | 62.222 | WP_158605034 |
hypothetical protein [Firmicutes bacterium ASF500] hypothetical protein N510_01368 [Firmicutes bacterium ASF500] |
5.47e-08 | 96 | 54.545 | WP_023347089 |
hypothetical protein [Anaerotruncus sp. 1XD22-93] |
3.42e-07 | 91 | 61.905 | WP_158604876 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_56 In blautia CP039126.1
Seq (len = 46 ):
MEDNMTDKQFKTILEMFGMILDGCKDLEEAKKKVEKLLEEQKNKSE
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|153241|1|4151451-4151622
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
7.192285293268079
unique PSMS
6
unique PSMS
6
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_57 In blautia CP039126.1
Seq (len = 66 ):
MGIKVKVNFDKRKLESAIKDQARESLRNRSYDAKCPFCHTTFSAHPGPNVCPHCRKTVDLNLNIKL
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|146236|1|3946668-3946884
Transkriptom
92.0% of gene length expressed over median expression of contig.
ŝ
6.842845560093718
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Blautia producta] |
1.76e-22 | 100 | 100.000 | WP_018597921 |
hypothetical protein [Clostridiales bacterium VE202-06] |
3.44e-22 | 100 | 97.826 | WP_155857321 |
hypothetical protein EV205_101155 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
7.34e-22 | 100 | 97.826 | TCO67169 |
hypothetical protein PMF13cell1_04453 [Blautia producta] |
8.38e-22 | 100 | 97.826 | QBE98884 |
MULTISPECIES: hypothetical protein [Lachnoclostridium] |
3.79e-11 | 91 | 73.810 | WP_157127772 |
hypothetical protein [[Eubacterium] eligens] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] hypothetical protein [[Eubacterium] rectale] |
1.21e-10 | 91 | 71.429 | WP_154268336 |
hypothetical protein [Anaerotruncus sp. 1XD22-93] |
2.44e-09 | 98 | 62.222 | WP_158605034 |
hypothetical protein [Firmicutes bacterium ASF500] hypothetical protein N510_01368 [Firmicutes bacterium ASF500] |
5.47e-08 | 96 | 54.545 | WP_023347089 |
hypothetical protein [Anaerotruncus sp. 1XD22-93] |
3.42e-07 | 91 | 61.905 | WP_158604876 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_58 In bact CP040530.1
Seq (len = 20 ):
ISTRRMNWLILLLHHGTIWR
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|84113|1|2033032-2033122
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
3.1021897007414743
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_59 In bact CP040530.1
Seq (len = 12 ):
MPQWLGTGVQKY
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|433726|-1|2147451-2147658
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
3.7524031216672453
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_60 In bifi AE014295.3
Seq (len = 54 ):
MPAEIHSGPFSVMSTSSSMRMPMPRYSGGISRSSSRKYRPGSMVKIMPGVIFAP
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|5605|1|247360-247615
Transkriptom
92.0% of gene length expressed over median expression of contig.
ŝ
2.2487208960166574
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_61 In bact CP040530.1
Seq (len = 61 ):
MSIEDAIMGGIVFKGKKDKPQEEEKVKTKAKKATYIRGQHGSGAAKMKADIRKKRANRHKK
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|295342|-1|5522998-5523415
Transkriptom
28.999999999999996% of gene length expressed over median expression of contig.
ŝ
4.665680311045504
unique PSMS
5
unique PSMS
5
Genomic Context
Candidate has annotation on OTHER strand. Which has 6 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Bacteroides thetaiotaomicron] conserved hypothetical protein [Bacteroides sp. 1_1_14] hypothetical protein C799_00309 [Bacteroides thetaiotaomicron dnLKV9] putative uncharacterized protein [Bacteroides thetaiotaomicron CAG:40] hypothetical protein SAMN02910431_02806 [Bacteroides sp. AR20] hypothetical protein Btheta7330_01484 [Bacteroides thetaiotaomicron] |
4.45e-34 | 100 | 100.000 | WP_008762146 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein GD631_16090 [Bacteroides sp. HF-5141] hypothetical protein FNW54_16385 [Bacteroides sp. HF-5092] |
1.94e-33 | 100 | 98.361 | WP_143259478 |
MULTISPECIES: hypothetical protein [Bacteroides] putative uncharacterized protein [Bacteroides faecis CAG:32] hypothetical protein SAMN05444400_11527 [Bacteroides faecis MAJ27] hypothetical protein F2Z43_19310 [Bacteroides faecis] hypothetical protein F2Z14_22295 [Bacteroides faecis] hypothetical protein F2Z41_15130 [Bacteroides faecis] |
2.58e-33 | 100 | 98.361 | WP_010538838 |
hypothetical protein [Bacteroides caccae] hypothetical protein BACCAC_02883 [Bacteroides caccae ATCC 43185] hypothetical protein HMPREF1061_02632 [Bacteroides caccae CL03T12C61] hypothetical protein BHV72_04830 [Bacteroides sp. 43_46] uncharacterized protein BN535_00557 [Bacteroides caccae CAG:21] hypothetical protein CGC64_16170 [Bacteroides caccae] |
8.73e-33 | 100 | 96.721 | WP_005678528 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DXB58_24245 [Bacteroides sp. OM05-10AA] hypothetical protein DWY87_24605 [Bacteroides sp. AF27-33] uncharacterized protein BN772_00059 [Bacteroides sp. CAG:754] |
1.51e-32 | 100 | 96.721 | WP_022136515 |
hypothetical protein [Bacteroides stercorirosoris] hypothetical protein BHV75_01940 [Bacteroides oleiciplenus] hypothetical protein DXA68_14505 [Bacteroides stercorirosoris] hypothetical protein SAMN05444350_13437 [Bacteroides stercorirosoris] |
1.24e-27 | 98 | 85.000 | WP_025832747 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein GD630_09995 [Bacteroides sp. HF-5287] hypothetical protein FOJ72_10185 [Bacteroides sp. HF-5300] |
6.91e-23 | 100 | 91.803 | WP_143866554 |
hypothetical protein [Bacteroides pyogenes] hypothetical protein HMPREF1981_01049 [Bacteroides pyogenes F0041] hypothetical protein JCM10003_2127 [Bacteroides pyogenes JCM 10003] Uncharacterised protein [Bacteroides pyogenes] |
7.06e-23 | 100 | 93.443 | WP_021644410 |
hypothetical protein [Bacteroides intestinalis] hypothetical protein DWW10_06375 [Bacteroides intestinalis] hypothetical protein DW932_06785 [Bacteroides intestinalis] hypothetical protein DW712_04780 [Bacteroides intestinalis] uncharacterized protein BN604_00062 [Bacteroides intestinalis CAG:315] |
2.54e-22 | 98 | 86.667 | WP_022391360 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein F3B37_06605 [Bacteroides intestinalis] hypothetical protein DXK01_013375 [Bacteroides intestinalis] hypothetical protein DXD57_20150 [Bacteroides intestinalis] hypothetical protein DXD27_11230 [Bacteroides intestinalis] hypothetical protein DWX27_12930 [Bacteroides intestinalis] |
2.54e-22 | 98 | 88.333 | WP_044155084 |
hypothetical protein [Bacteroides pyogenes] hypothetical protein JCM6292_716 [Bacteroides pyogenes JCM 6292] hypothetical protein FNJ60_04760 [Bacteroides pyogenes] hypothetical protein FNJ61_09685 [Bacteroides pyogenes] hypothetical protein FNJ59_10500 [Bacteroides pyogenes] hypothetical protein FNG97_04200 [Bacteroides pyogenes] |
4.57e-22 | 100 | 91.803 | WP_027325498 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein KGMB02408_28040 [Bacteroides sp. KCTC 15687] |
1.24e-21 | 100 | 91.803 | WP_077153643 |
hypothetical protein [Bacteroides helcogenes] hypothetical protein Bache_1831 [Bacteroides helcogenes P 36-108] |
1.24e-21 | 100 | 86.885 | WP_013547403 |
hypothetical protein [Bacteroides oleiciplenus] hypothetical protein HMPREF9447_03464 [Bacteroides oleiciplenus YIT 12058] hypothetical protein DXB65_05910 [Bacteroides oleiciplenus] |
1.47e-21 | 98 | 83.333 | WP_009130994 |
hypothetical protein [Bacteroides timonensis] |
2.61e-21 | 98 | 86.667 | WP_044270930 |
hypothetical protein [Bacteroides faecichinchillae] hypothetical protein E5981_13765 [Bacteroides faecichinchillae] hypothetical protein SAMN05444349_14519 [Bacteroides faecichinchillae] |
2.83e-21 | 100 | 91.803 | WP_025075848 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BACCELL_04015 [Bacteroides cellulosilyticus DSM 14838] hypothetical protein HMPREF1062_01283 [Bacteroides cellulosilyticus CL02T12C19] uncharacterized protein BN506_03818 [Bacteroides cellulosilyticus CAG:158] Uncharacterised protein [uncultured Bacteroides sp.] hypothetical protein BcellWH2_04807 [Bacteroides cellulosilyticus] |
6.71e-21 | 98 | 85.000 | WP_007213360 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BACEGG_01648 [Bacteroides eggerthii DSM 20697] hypothetical protein HMPREF1016_02786 [Bacteroides eggerthii 1_2_48FAA] putative uncharacterized protein [Bacteroides eggerthii CAG:109] hypothetical protein F2Z23_02000 [Bacteroides eggerthii] hypothetical protein F2Z10_17075 [Bacteroides eggerthii] |
8.6e-21 | 98 | 86.667 | WP_004289940 |
hypothetical protein [Bacteroidaceae bacterium HV4-6-C5C] hypothetical protein FQ707_13075 [Bacteroidaceae bacterium HV4-6-C5C] |
1.17e-20 | 98 | 88.333 | WP_146268014 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF9445_01419 [Bacteroides clarus YIT 12056] hypothetical protein BHV73_04520 [Bacteroides sp. 44_46] putative uncharacterized protein [Bacteroides clarus CAG:160] hypothetical protein B5F24_06695 [Bacteroides clarus] hypothetical protein DWX38_05410 [Bacteroides clarus] |
3.91e-20 | 98 | 85.000 | WP_009121572 |
hypothetical protein [Bacteroides clarus] hypothetical protein B5F97_15435 [Bacteroides clarus] |
8.72e-20 | 98 | 83.333 | WP_087426796 |
hypothetical protein [Bacteroides sp. OM08-17BH] hypothetical protein DXC20_15720 [Bacteroides sp. OM08-17BH] hypothetical protein [Bacteroides sp.] |
1.94e-19 | 98 | 86.667 | WP_117713234 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DW121_07695 [Bacteroides sp. AM10-21B] |
2.45e-19 | 98 | 86.667 | WP_118323446 |
hypothetical protein [Bacteroides salyersiae] hypothetical protein HMPREF1071_03606 [Bacteroides salyersiae CL02T12C01] hypothetical protein HMPREF1532_02695 [Bacteroides salyersiae WAL 10018 = DSM 18765 = JCM 12988] |
2.5e-19 | 100 | 85.484 | WP_005930259 |
hypothetical protein [Bacteroides pyogenes] |
3.88e-19 | 93 | 91.228 | WP_152532456 |
hypothetical protein [Bacteroides salyersiae] uncharacterized protein BN523_02153 [Bacteroides sp. CAG:189] hypothetical protein F3F90_12195 [Bacteroides salyersiae] hypothetical protein F3F89_14560 [Bacteroides salyersiae] hypothetical protein F3F88_05130 [Bacteroides salyersiae] hypothetical protein F3G09_24180 [Bacteroides salyersiae] |
5.51e-19 | 100 | 83.871 | WP_021936424 |
hypothetical protein JCM6294_1142 [Bacteroides pyogenes DSM 20611 = JCM 6294] |
5.52e-19 | 93 | 91.228 | GAE18267 |
hypothetical protein BACUNI_04456 [Bacteroides uniformis ATCC 8492] hypothetical protein HMPREF0969_02872 [Bacteroides sp. D20] hypothetical protein HMPREF2141_02931 [Bacteroides uniformis] hypothetical protein Bun01g_31870 [Bacteroides uniformis] Uncharacterised protein [Catenibacterium mitsuokai] |
2.02e-18 | 100 | 81.967 | EDO51906 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein C801_03716 [Bacteroides uniformis dnLKV2] hypothetical protein M093_2175 [Bacteroides uniformis str. 3978 T3 i] predicted protein [Bacteroides uniformis CAG:3] hypothetical protein HMPREF1007_02664 [Bacteroides sp. 4_1_36] hypothetical protein GAS34_15760 [Bacteroides uniformis] |
2.24e-18 | 100 | 81.967 | WP_008664928 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DXC10_12045 [Bacteroides sp. OM08-11] |
2.54e-18 | 98 | 85.000 | WP_101543241 |
hypothetical protein [Bacteroides ndongoniae] putative uncharacterized protein [Bacteroides sp. CAG:633] |
7.04e-18 | 98 | 81.667 | WP_022164271 |
hypothetical protein [Bacteroides uniformis] hypothetical protein HMPREF1072_00240 [Bacteroides uniformis CL03T00C23] hypothetical protein HMPREF1073_00717 [Bacteroides uniformis CL03T12C37] |
1.23e-17 | 100 | 80.328 | WP_005832457 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein A4V03_11755 [Bacteroides caecimuris] hypothetical protein ADH74_00025 [Bacteroides caecimuris] hypothetical protein D7W50_02525 [Bacteroides caecimuris] hypothetical protein E5353_17505 [Bacteroides caecimuri] |
1.84e-17 | 100 | 95.082 | WP_065539069 |
hypothetical protein [Bacteroides acidifaciens] hypothetical protein D7V84_11830 [Bacteroides acidifaciens] hypothetical protein D7Y07_11775 [Bacteroides acidifaciens] hypothetical protein E4T97_12560 [Bacteroides acidifaciens] hypothetical protein E5356_18695 [Bacteroides acidifaciens] |
1.97e-17 | 100 | 95.082 | WP_024987546 |
MULTISPECIES: hypothetical protein [Bacteria] hypothetical protein BACOVA_04323 [Bacteroides ovatus ATCC 8483] conserved hypothetical protein [Bacteroides ovatus SD CMC 3f] conserved hypothetical protein [Bacteroides xylanisolvens SD CC 2a] conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein HMPREF1017_02027 [Bacteroides ovatus 3_8_47FAA] hypothetical protein HMPREF1070_04098 [Bacteroides ovatus CL03T12C18] hypothetical protein HMPREF1069_03380 [Bacteroides ovatus CL02T12C04] hypothetical protein HMPREF1074_04149 [Bacteroides xylanisolvens CL03T12C04] hypothetical protein M088_1431 [Bacteroides ovatus str. 3725 D1 iv] hypothetical protein M082_1474 [Bacteroides fragilis str. 3725 D9 ii] hypothetical protein M089_3557 [Bacteroides ovatus str. 3725 D9 iii] hypothetical protein BXY_45780 [Bacteroides xylanisolvens XB1A] uncharacterized protein BN541_03866 [Bacteroides ovatus CAG:22] hypothetical protein BACOV975_04459 [Bacteroides ovatus V975] |
3.37e-17 | 100 | 95.082 | WP_004300779 |
hypothetical protein [Bacteroides finegoldii] hypothetical protein BACFIN_09086 [Bacteroides finegoldii DSM 17565] hypothetical protein HMPREF1057_03365 [Bacteroides finegoldii CL09T03C10] putative uncharacterized protein [Bacteroides finegoldii CAG:203] hypothetical protein F2Z28_13085 [Bacteroides finegoldii] hypothetical protein F2Z16_12915 [Bacteroides finegoldii] |
1.09e-16 | 100 | 93.443 | WP_007758122 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein DW691_17130 [Bacteroides xylanisolvens] hypothetical protein DW027_18805 [Bacteroides xylanisolvens] |
1.27e-16 | 100 | 93.443 | WP_118219899 |
hypothetical protein [Bacteroides sp. 2_2_4] hypothetical protein F3D71_15015 [Bacteroides ovatus] |
1.48e-16 | 100 | 95.082 | WP_032849269 |
hypothetical protein [Bacteroides graminisolvens] |
1.7e-15 | 100 | 64.516 | HAZ58332 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF1068_03277 [Bacteroides nordii CL02T12C05] hypothetical protein HMPREF1214_03430 [Bacteroides sp. HPS0048] hypothetical protein BHV71_03950 [Bacteroides sp. 41_26] hypothetical protein DW888_01530 [Bacteroides nordii] |
1.74e-15 | 100 | 80.645 | WP_002561340 |
hypothetical protein [Bacteroides reticulotermitis] |
2.16e-15 | 100 | 91.803 | WP_044161945 |
hypothetical protein [Bacteroides graminisolvens] hypothetical protein [Bacteroides graminisolvens] |
2.26e-15 | 100 | 64.516 | WP_027317910 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BFAG_00671 [Bacteroides fragilis 3_1_12] hypothetical protein HMPREF1055_01461 [Bacteroides fragilis CL07T00C01] hypothetical protein HMPREF1067_03841 [Bacteroides fragilis CL03T12C07] hypothetical protein HMPREF1066_01444 [Bacteroides fragilis CL03T00C08] hypothetical protein HMPREF1079_00702 [Bacteroides fragilis CL05T00C42] hypothetical protein HMPREF1056_01461 [Bacteroides fragilis CL07T12C05] hypothetical protein HMPREF1080_01392 [Bacteroides fragilis CL05T12C13] hypothetical protein HMPREF1205_02876 [Bacteroides fragilis HMW 616] hypothetical protein HMPREF1204_03217 [Bacteroides fragilis HMW 615] hypothetical protein HMPREF1203_02633 [Bacteroides fragilis HMW 610] hypothetical protein M077_1419 [Bacteroides fragilis str. 2-F-2 #5] hypothetical protein M145_1300 [Bacteroides fragilis str. 34-F-2 #13] hypothetical protein M117_1214 [Bacteroides fragilis str. 3774 T13] hypothetical protein M118_1240 [Bacteroides fragilis str. 3783N1-2] hypothetical protein M083_1378 [Bacteroides fragilis str. 3986 T(B)9] hypothetical protein M124_4691 [Bacteroides fragilis str. 3988T(B)14] hypothetical protein M084_1314 [Bacteroides fragilis str. 3988 T1] hypothetical protein M079_1527 [Bacteroides fragilis str. 3996 N(B) 6] hypothetical protein M074_1385 [Bacteroides fragilis str. DS-166] hypothetical protein M067_1317 [Bacteroides fragilis str. J-143-4] hypothetical protein M076_1402 [Bacteroides fragilis str. 2-F-2 #4] hypothetical protein M107_2217 [Bacteroides fragilis str. 3725 D9(v)] hypothetical protein M120_1740 [Bacteroides fragilis str. 3783N1-8] hypothetical protein M144_1430 [Bacteroides fragilis str. 3-F-2 #6] hypothetical protein M068_1360 [Bacteroides fragilis str. J38-1] hypothetical protein M087_1315 [Bacteroides fragilis str. S23 R14] hypothetical protein M115_1315 [Bacteroides fragilis str. 3719 T6] hypothetical protein M114_1283 [Bacteroides fragilis str. 3986 N(B)22] hypothetical protein M070_1327 [Bacteroides fragilis str. A7 (UDC12-2)] hypothetical protein M132_1261 [Bacteroides fragilis str. S24L15] hypothetical protein M133_1314 [Bacteroides fragilis str. S24L26] hypothetical protein M135_1531 [Bacteroides fragilis str. S36L5] hypothetical protein M129_1286 [Bacteroides fragilis str. S6R5] hypothetical protein M140_1293 [Bacteroides fragilis str. S38L3] hypothetical protein M066_1447 [Bacteroides fragilis str. I1345] hypothetical protein M138_1451 [Bacteroides fragilis str. S23L17] hypothetical protein M131_1336 [Bacteroides fragilis str. S6R8] conserved hypothetical protein [Bacteroides fragilis NCTC 9343] conserved hypothetical protein [Bacteroides fragilis 638R] putative uncharacterized protein [Bacteroides fragilis CAG:558] putative uncharacterized protein [Bacteroides fragilis CAG:47] |
2.73e-15 | 100 | 79.032 | WP_005776115 |
hypothetical protein [Alloprevotella tannerae] |
8.57e-15 | 97 | 61.017 | WP_040599490 |
hypothetical protein [Bacteroides sp.] |
1.6e-14 | 98 | 60.000 | HBB07420 |
hypothetical protein M094_1435 [Bacteroides uniformis str. 3978 T3 ii] |
5.24e-14 | 89 | 83.333 | KDS50509 |
hypothetical protein [Bacteroides luti] hypothetical protein SAMN05444405_104216 [Bacteroides luti] |
8.37e-14 | 95 | 62.295 | WP_073400022 |
hypothetical protein [Bacteroides fragilis] hypothetical protein M086_1277 [Bacteroides fragilis str. S13 L11] hypothetical protein M147_1450 [Bacteroides fragilis str. 1007-1-F #4] hypothetical protein M103_1596 [Bacteroides fragilis str. 1007-1-F #9] hypothetical protein M148_1498 [Bacteroides fragilis str. 1007-1-F #5] hypothetical protein M149_1613 [Bacteroides fragilis str. 1007-1-F #6] |
8.83e-14 | 100 | 77.419 | WP_032533011 |
uncharacterized protein BN773_01350 [Prevotella sp. CAG:755] |
2.87e-13 | 92 | 64.286 | CCY15382 |
hypothetical protein [Bacteroides zoogleoformans] hypothetical protein C4H11_13430 [Bacteroides zoogleoformans] hypothetical protein JN06_00346 [Bacteroides zoogleoformans] |
6.08e-13 | 100 | 78.689 | WP_106042756 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF1534_03103 [Bacteroides massiliensis B84634 = Timone 84634 = DSM 17679 = JCM 13223] putative uncharacterized protein [Bacteroides sp. CAG:98] hypothetical protein DW267_12560 [Bacteroides sp. AM22-3LB] hypothetical protein DW175_13240 [Bacteroides sp. AM16-15] hypothetical protein DW683_10570 [Bacteroides sp. AM25-34] |
7.44e-13 | 98 | 73.770 | WP_005943048 |
hypothetical protein [Bacteroides heparinolyticus] hypothetical protein C3V43_01280 [Bacteroides heparinolyticus] hypothetical protein EII33_02715 [Bacteroides heparinolyticus] hypothetical protein EV202_13617 [Bacteroides heparinolyticus] Uncharacterised protein [Bacteroides heparinolyticus] |
8.54e-13 | 100 | 81.967 | WP_106068268 |
hypothetical protein [Mediterranea massiliensis] putative uncharacterized protein [Bacteroides sp. CAG:661] |
8.73e-13 | 100 | 81.967 | WP_022019495 |
hypothetical protein [Bacteroides ihuae] |
1.75e-12 | 98 | 73.016 | WP_071145370 |
hypothetical protein [Bacteroides togonis] putative uncharacterized protein [Bacteroides sp. CAG:598] |
3.71e-12 | 100 | 80.328 | WP_021847527 |
hypothetical protein [Bacteroides sartorii] hypothetical protein C802_04352 [Bacteroides sartorii] hypothetical protein E5339_09695 [Bacteroides sartorii] |
8.97e-12 | 98 | 70.492 | WP_016278523 |
hypothetical protein [Phocaeicola abscessus] |
1.15e-11 | 95 | 60.000 | WP_019207607 |
hypothetical protein [Parabacteroides chartae] hypothetical protein SAMN05660349_01845 [Parabacteroides chartae] |
1.23e-11 | 95 | 53.333 | WP_079683369 |
hypothetical protein HMPREF9012_1967 [Bacteroidetes bacterium oral taxon 272 str. F0290] |
1.26e-11 | 95 | 60.000 | EPT32937 |
hypothetical protein [Bacteroides sp. AM23-18] hypothetical protein DW646_20185 [Bacteroides sp. AM23-18] |
1.45e-11 | 98 | 70.492 | WP_117475700 |
MULTISPECIES: hypothetical protein [Bacteroides] conserved hypothetical protein [Bacteroides vulgatus ATCC 8482] conserved hypothetical protein [Bacteroides vulgatus PC510] hypothetical protein HMPREF1058_03897 [Bacteroides vulgatus CL09T03C04] hypothetical protein C800_04082 [Bacteroides vulgatus dnLKV7] hypothetical protein M097_2351 [Bacteroides vulgatus str. 3775 SL(B) 10 (iv)] hypothetical protein M098_4223 [Bacteroides vulgatus str. 3775 SR(B) 19] hypothetical protein M099_1207 [Bacteroides vulgatus str. 3975 RP4] hypothetical protein [Turicibacter sanguinis] putative uncharacterized protein [Bacteroides vulgatus CAG:6] hypothetical protein [Bacteroides sp.] |
1.66e-11 | 98 | 70.492 | WP_005839609 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein ABI39_08350 [Bacteroides dorei CL03T12C01] hypothetical protein BACDOR_00317 [Bacteroides dorei DSM 17855] hypothetical protein BSEG_04173 [Bacteroides dorei 5_1_36/D4] hypothetical protein HMPREF1063_04955 [Bacteroides dorei CL02T00C15] hypothetical protein HMPREF1064_05022 [Bacteroides dorei CL02T12C06] uncharacterized protein BN543_00828 [Bacteroides dorei CAG:222] |
1.81e-11 | 98 | 70.492 | WP_007831411 |
hypothetical protein [Mediterranea sp. An20] hypothetical protein B5F34_10100 [Mediterranea sp. An20] |
1.82e-11 | 84 | 84.314 | WP_087338242 |
hypothetical protein [Macellibacteroides sp. HH-ZS] hypothetical protein A9168_16150 [Macellibacteroides sp. HH-ZS] |
2.99e-11 | 95 | 53.333 | WP_068187205 |
uncharacterized protein BN736_00801 [Prevotella sp. CAG:617] |
4.75e-11 | 95 | 60.345 | CDF22908 |
hypothetical protein [Bacteroides dorei] hypothetical protein F2Y92_15060 [Bacteroides dorei] |
6.18e-11 | 98 | 68.852 | WP_149928533 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein DXB63_08190 [Bacteroides sp. OM05-12] hypothetical protein DWW69_08790 [Bacteroides sp. AF16-49] |
8.31e-11 | 100 | 68.254 | WP_122125924 |
hypothetical protein [Bacteroides fluxus] hypothetical protein HMPREF9446_01757 [Bacteroides fluxus YIT 12057] |
9.64e-11 | 100 | 81.967 | WP_009125039 |
hypothetical protein [Alloprevotella rava] hypothetical protein HMPREF9332_01772 [Alloprevotella rava F0323] |
1.24e-10 | 95 | 72.881 | WP_009348305 |
MULTISPECIES: hypothetical protein [unclassified Prevotellaceae] |
1.31e-10 | 95 | 70.690 | WP_075564488 |
hypothetical protein JCM10512_1936 [Bacteroides reticulotermitis JCM 10512] |
1.67e-10 | 89 | 92.593 | GAE83645 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein F9968_13075 [Bacteroides stercoris] hypothetical protein F9966_12450 [Bacteroides stercoris] hypothetical protein F9962_12645 [Bacteroides stercoris] hypothetical protein F9957_12760 [Bacteroides stercoris] hypothetical protein F9964_09175 [Bacteroides stercoris] |
3.34e-10 | 98 | 83.333 | WP_025068822 |
hypothetical protein M078_1409 [Bacteroides fragilis str. 2-F-2 #7] hypothetical protein M080_1374 [Bacteroides fragilis str. 3397 T10] hypothetical protein M121_1294 [Bacteroides fragilis str. 3783N2-1] hypothetical protein M122_1244 [Bacteroides fragilis str. 3976T7] hypothetical protein M111_1249 [Bacteroides fragilis str. 3986T(B)10] hypothetical protein M085_1215 [Bacteroides fragilis str. 3986 N(B)19] hypothetical protein M125_1857 [Bacteroides fragilis str. 3998T(B)3] hypothetical protein M081_1530 [Bacteroides fragilis str. 3998 T(B) 4] hypothetical protein M072_1283 [Bacteroides fragilis str. DS-208] hypothetical protein M073_1220 [Bacteroides fragilis str. DS-71] hypothetical protein M071_1261 [Bacteroides fragilis str. Ds-233] hypothetical protein M136_1375 [Bacteroides fragilis str. S36L11] hypothetical protein M109_1693 [Bacteroides fragilis str. 3397 N2] hypothetical protein M108_1383 [Bacteroides fragilis str. 3397 T14] hypothetical protein M116_1432 [Bacteroides fragilis str. 3719 A10] hypothetical protein M123_1529 [Bacteroides fragilis str. 3976T8] hypothetical protein M069_1559 [Bacteroides fragilis str. B1 (UDC16-1)] hypothetical protein M065_2257 [Bacteroides fragilis str. Korea 419] hypothetical protein M126_1553 [Bacteroides fragilis str. S6L3] hypothetical protein M130_1345 [Bacteroides fragilis str. S6R6] hypothetical protein M106_1424 [Bacteroides fragilis str. 1009-4-F #10] hypothetical protein M105_1928 [Bacteroides fragilis str. 1009-4-F #7] hypothetical protein M075_1515 [Bacteroides fragilis str. 20793-3] hypothetical protein M110_1457 [Bacteroides fragilis str. 3397 N3] hypothetical protein M112_1484 [Bacteroides fragilis str. 3986 T(B)13] hypothetical protein M139_1476 [Bacteroides fragilis str. S23L24] hypothetical protein M134_1479 [Bacteroides fragilis str. S24L34] hypothetical protein M137_1885 [Bacteroides fragilis str. S36L12] hypothetical protein M141_1349 [Bacteroides fragilis str. S38L5] hypothetical protein M128_1415 [Bacteroides fragilis str. S6L8] hypothetical protein M119_1732 [Bacteroides fragilis str. 3783N1-6] hypothetical protein M127_1361 [Bacteroides fragilis str. S6L5] hypothetical protein M113_1473 [Bacteroides fragilis str. 3986 N3] |
4.84e-10 | 89 | 78.182 | EXY22875 |
hypothetical protein [Bacteroides stercoris] hypothetical protein BACSTE_00298 [Bacteroides stercoris ATCC 43183] hypothetical protein HMPREF1181_02302 [Bacteroides stercoris CC31F] uncharacterized protein BN477_01951 [Bacteroides stercoris CAG:120] hypothetical protein F9952_12310 [Bacteroides stercoris] hypothetical protein F9953_14125 [Bacteroides stercoris] |
6.16e-10 | 98 | 81.667 | WP_005652688 |
hypothetical protein [Prevotella sp. MGM2] |
1.13e-09 | 95 | 68.333 | WP_104404995 |
hypothetical protein [Prevotellaceae bacterium] |
1.41e-09 | 92 | 60.000 | HBC28522 |
uncharacterized protein BN487_00174 [Prevotella sp. CAG:1320] |
1.64e-09 | 95 | 54.237 | CDA92771 |
hypothetical protein [Bacteroides sp. OF04-15BH] hypothetical protein DXA74_02550 [Bacteroides sp. OF04-15BH] |
1.83e-09 | 95 | 68.852 | WP_118525253 |
hypothetical protein [Paraprevotella clara] hypothetical protein HMPREF9441_02191 [Paraprevotella clara YIT 11840] putative uncharacterized protein [Paraprevotella clara CAG:116] |
2e-09 | 97 | 63.934 | WP_008620544 |
hypothetical protein PvtlMGM2_1665 [Prevotella sp. MGM2] |
2.14e-09 | 95 | 68.333 | GAY30812 |
hypothetical protein [Paraprevotella xylaniphila] hypothetical protein HMPREF9442_03396 [Paraprevotella xylaniphila YIT 11841] hypothetical protein [Paraprevotella xylaniphila] |
2.63e-09 | 97 | 63.934 | WP_008630192 |
hypothetical protein D8H91_00260 [Alloprevotella sp.] |
2.72e-09 | 95 | 68.966 | RKV82837 |
hypothetical protein [Paraprevotella clara] hypothetical protein DWW55_08955 [Paraprevotella clara] |
3.34e-09 | 97 | 65.574 | WP_118146876 |
hypothetical protein D8B56_08770 [Alloprevotella sp.] |
4.77e-09 | 95 | 67.241 | RKV70198 |
hypothetical protein [Prevotella sp. oral taxon 473] hypothetical protein HMPREF9999_02013 [Prevotella sp. oral taxon 473 str. F0040] |
5.67e-09 | 95 | 67.241 | WP_009752146 |
hypothetical protein [Bacteroidales bacterium KHT7] hypothetical protein SAMN05216518_14314 [Bacteroidales bacterium KHT7] |
7.27e-09 | 93 | 55.172 | WP_090684519 |
uncharacterized protein BN461_00949 [Bacteroides sp. CAG:1076] |
7.6e-09 | 98 | 63.934 | CCY93558 |
hypothetical protein [Bacteroides coprocola] hypothetical protein BACCOP_03601 [Bacteroides coprocola DSM 17136] hypothetical protein DWY20_05115 [Bacteroides coprocola] uncharacterized protein BN509_00091 [Bacteroides coprocola CAG:162] hypothetical protein [Bacteroides sp.] |
8.11e-09 | 98 | 63.934 | WP_007571078 |
hypothetical protein [Alloprevotella sp. E39] hypothetical protein C7Y71_000265 [Alloprevotella sp. E39] |
1.02e-08 | 95 | 66.102 | WP_111899310 |
hypothetical protein [Bacteroides neonati] |
1.2e-08 | 98 | 70.492 | WP_042367867 |
hypothetical protein [Bacteroides ilei] |
1.24e-08 | 98 | 65.000 | WP_072531929 |
hypothetical protein M101_1341 [Bacteroides fragilis str. 1007-1-F #8] hypothetical protein M100_1400 [Bacteroides fragilis str. 1007-1-F #7] hypothetical protein M104_1593 [Bacteroides fragilis str. 1007-1-F #10] hypothetical protein M146_1770 [Bacteroides fragilis str. 1007-1-F #3] |
1.42e-08 | 89 | 76.364 | EXY13940 |
hypothetical protein [Bacteroides sp. Marseille-P3684] uncharacterized protein BN666_02126 [Bacteroides sp. CAG:462] |
1.61e-08 | 82 | 58.000 | WP_022385397 |
hypothetical protein [Bacteroides barnesiae] uncharacterized protein BN762_02237 [Bacteroides sp. CAG:714] |
2.04e-08 | 98 | 66.129 | WP_018711641 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] |
2.1e-08 | 93 | 53.448 | WP_031533984 |
hypothetical protein [Alloprevotella sp. OH1205_COT-284] hypothetical protein EII14_08375 [Alloprevotella sp. OH1205_COT-284] |
2.45e-08 | 95 | 65.517 | WP_124932086 |
hypothetical protein [Bacteroides sp. An322] hypothetical protein B5F91_04275 [Bacteroides sp. An322] |
3.44e-08 | 98 | 65.000 | WP_087427874 |
hypothetical protein [Prevotellamassilia timonensis] uncharacterized protein BN693_00761 [Prevotella sp. CAG:5226] |
4.17e-08 | 95 | 66.102 | WP_022101701 |
MULTISPECIES: hypothetical protein [Prevotella] hypothetical protein HMPREF1199_02162 [Prevotella oralis CC98A] |
6.25e-08 | 98 | 60.656 | WP_023984669 |
hypothetical protein [Bacteroides coprophilus] hypothetical protein BACCOPRO_01858 [Bacteroides coprophilus DSM 18228 = JCM 13818] |
6.79e-08 | 98 | 63.934 | WP_008142637 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_62 In anaero CP036345.1
Seq (len = 20 ):
GGESQELKAGFPAMPREESV
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|3851|1|93002-93062
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.383699569557427
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_63 In lacto CP039121.1
Seq (len = 48 ):
MACSNMAIKLDNRITESNAYLYCDPPAIDVIQFPGSMYPTATSAPGPV
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|158015|1|3003111-3003723
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.3865105468912553
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_64 In blautia CP039126.1
Seq (len = 49 ):
ISKADTPTESTWGSKVPSIRMRPIFTFGLFFLKYHRVTAAWINWERIVA
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|430806|-1|543929-544109
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.6407971390129106
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_65 In blautia CP039126.1
Seq (len = 39 ):
LSSTLQIDLFPSVIRSIRSLHFTQKSYSSIHRGFHICVF
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|218537|1|6149309-6149501
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.2904473872199174
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 18 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
ABC-type transport system,ATP-binding protein [Clostridioides difficile 630]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
conserved hypothetical protein [Natranaerobius thermophilus JW/NM-WN-LF] |
7.78e-16 | 97 | 58.929 | ACB84405 |
Uncharacterised protein [[Eubacterium] contortum] [Faecalicatena contorta] |
1.44e-13 | 95 | 58.182 | CUO70562 |
hypothetical protein [Firmicutes bacterium] |
6.88e-13 | 97 | 51.786 | MTI96807 |
hypothetical protein HMPREF0994_06176 [Lachnospiraceae bacterium 3_1_57FAA_CT1] hypothetical protein BEI61_01198 [Eisenbergiella tayi] Uncharacterised protein [Fusicatenibacter sp. 2789STDY5834925] |
3.34e-11 | 98 | 49.123 | EGN30669 |
hypothetical protein Cbu04g_08690 [Clostridium butyricum] hypothetical protein CBU03nite_26250 [Clostridium butyricum] |
8.27e-11 | 93 | 51.852 | BBK75861 |
Uncharacterised protein [Blautia wexlerae] |
1.37e-10 | 98 | 49.123 | CUP56275 |
hypothetical protein C817_03485 [Dorea sp. 5-2] |
1.93e-10 | 95 | 50.909 | EOS78962 |
hypothetical protein LX24_01078 [Desulfallas thermosapovorans DSM 6562] |
5.07e-10 | 97 | 46.429 | TYO96609 |
hypothetical protein HMPREF0988_02568 [Lachnospiraceae bacterium 1_4_56FAA] |
1.15e-09 | 95 | 49.091 | EGN35448 |
hypothetical protein DJ90_237 [Paenibacillus macerans] hypothetical protein PbDSM24746_11870 [Paenibacillus thermophilus] hypothetical protein PbJCM17693_11940 [Paenibacillus thermophilus] Uncharacterised protein [Paenibacillus macerans] |
1.16e-09 | 93 | 51.852 | KFN05636 |
Uncharacterised protein [uncultured Clostridium sp.] |
1.64e-09 | 93 | 50.000 | SCH14314 |
hypothetical protein EV209_1018 [Cuneatibacter caecimuris] |
2.35e-09 | 98 | 47.368 | RZT02888 |
hypothetical protein HMPREF0262_00421 [Clostridium sp. ATCC 29733] hypothetical protein SAMN05444424_2631 [Clostridium sp. DSM 4029] |
2.41e-09 | 98 | 49.123 | ERJ00832 |
hypothetical protein D7X25_14600 [bacterium 1XD42-8] hypothetical protein D7Y09_13905 [bacterium 1XD42-1] |
4.65e-08 | 97 | 44.643 | RKJ52565 |
hypothetical protein Clole_1881 [Cellulosilyticum lentocellum DSM 5427] |
1.04e-07 | 95 | 43.636 | ADZ83601 |
hypothetical protein [Clostridioides difficile] |
1.1e-07 | 95 | 45.455 | WP_077727208 |
Uncharacterised protein [Clostridioides difficile] |
1.21e-07 | 95 | 45.455 | SJW28021 |
conserved hypothetical protein [Clostridium perfringens C str. JGS1495] hypothetical protein HMPREF3222_00396 [Clostridium perfringens] |
1.55e-07 | 95 | 43.636 | EDS80572 |
hypothetical protein [Anaeromassilibacillus sp. An200] hypothetical protein B5F35_07935 [Anaeromassilibacillus sp. An200] |
1.67e-07 | 97 | 41.071 | WP_087239760 |
hypothetical protein [Clostridioides difficile] hypothetical protein CD630_09390 [Clostridioides difficile 630] hypothetical protein phiC2p82 [Clostridium virus phiC2] conserved hypothetical protein [Clostridium phage phiCDHM19] hypothetical protein CDBPCV119_gp74 [Clostridium virus phiCD119] hypothetical protein QC7_1137 [Clostridioides difficile CD38] hypothetical protein [Clostridium virus phiCD119] hypothetical protein phiC2p82 [Clostridium virus phiC2] hypothetical protein CWR55_16830 [Clostridioides difficile] hypothetical protein DDG63_14550 [Clostridioides difficile] |
3.44e-07 | 95 | 43.636 | WP_011861023 |
hypothetical protein [Alkalibaculum bacchi] hypothetical protein DES36_10384 [Alkalibaculum bacchi] |
3.67e-07 | 93 | 42.593 | WP_113919755 |
hypothetical protein QUW_0257 [Clostridioides difficile P72] hypothetical protein QUO_2925 [Clostridioides difficile P64] |
3.7e-07 | 95 | 43.636 | EQK23754 |
hypothetical protein [Clostridioides difficile] conserved protein of unknown function [Clostridium phage phiMMP01] conserved protein of unknown function [Clostridium phage phiMMP03] putative phage protein [Peptoclostridium phage p630P1] [Clostridioides difficile 630] hypothetical protein QCA_0949 [Clostridioides difficile CD40] hypothetical protein QC9_0862 [Clostridioides difficile CD39] hypothetical protein QCG_3205 [Clostridioides difficile CD43] hypothetical protein QCO_3320 [Clostridioides difficile CD47] hypothetical protein QCK_0995 [Clostridioides difficile CD45] hypothetical protein QCQ_1056 [Clostridioides difficile CD49] hypothetical protein QCY_0930 [Clostridioides difficile CD70] hypothetical protein QEK_3144 [Clostridioides difficile CD131] hypothetical protein QES_1111 [Clostridioides difficile CD149] hypothetical protein QEQ_0258 [Clostridioides difficile CD144] hypothetical protein QG1_3325 [Clostridioides difficile CD166] hypothetical protein QEI_0849 [Clostridioides difficile CD129] hypothetical protein QGA_3640 [Clostridioides difficile CD181] hypothetical protein QGE_3112 [Clostridioides difficile CD200] hypothetical protein QIE_0925 [Clostridioides difficile DA00062] hypothetical protein QIO_1239 [Clostridioides difficile DA00129] hypothetical protein QK3_1013 [Clostridioides difficile DA00145] hypothetical protein QKI_3181 [Clostridioides difficile DA00189] hypothetical protein QKU_3363 [Clostridioides difficile DA00203] hypothetical protein QKW_0969 [Clostridioides difficile DA00210] hypothetical protein QM9_0983 [Clostridioides difficile DA00238] hypothetical protein QMK_0893 [Clostridioides difficile DA00273] hypothetical protein QMO_0874 [Clostridioides difficile DA00305] hypothetical protein QMS_1003 [Clostridioides difficile DA00307] hypothetical protein QMY_3641 [Clostridioides difficile F152] hypothetical protein QMU_0919 [Clostridioides difficile DA00310] hypothetical protein QOO_0943 [Clostridioides difficile Y165] hypothetical protein QOS_2334 [Clostridioides difficile Y184] hypothetical protein QOU_0863 [Clostridioides difficile Y202] hypothetical protein QQ3_3081 [Clostridioides difficile Y266] hypothetical protein QQC_3286 [Clostridioides difficile Y358] hypothetical protein QQM_0917 [Clostridioides difficile P2] hypothetical protein QQW_3005 [Clostridioides difficile P8] hypothetical protein QS3_0257 [Clostridioides difficile P13] hypothetical protein QS7_0809 [Clostridioides difficile P19] hypothetical protein QS9_3190 [Clostridioides difficile P20] hypothetical protein QSG_1262 [Clostridioides difficile P25] hypothetical protein QSE_0925 [Clostridioides difficile P24] hypothetical protein QUE_0253 [Clostridioides difficile P51] hypothetical protein QUM_1045 [Clostridioides difficile P78] hypothetical protein QUS_0919 [Clostridioides difficile P69] hypothetical protein QW7_1013 [Clostridioides difficile P77] hypothetical protein C676_3490 [Clostridioides difficile F548] hypothetical protein QE7_3290 [Clostridioides difficile CD92] hypothetical protein QEE_1029 [Clostridioides difficile CD113] hypothetical protein QEC_0892 [Clostridioides difficile CD111] hypothetical protein QE1_1025 [Clostridioides difficile CD86] hypothetical protein QSS_0933 [Clostridioides difficile P33] hypothetical protein QUQ_0269 [Clostridioides difficile P68] Putative phage protein [Clostridioides difficile E10] Putative phage protein [Clostridioides difficile T22] Putative phage protein [Clostridioides difficile E25] Putative phage protein [Clostridioides difficile T15] Putative phage protein [Clostridioides difficile T11] Putative phage protein [Clostridioides difficile E15] Putative phage protein [Clostridioides difficile T42] Putative phage protein [Clostridioides difficile E9] Putative phage protein [Clostridioides difficile E7] Putative phage protein [Clostridioides difficile T3] Putative phage protein [Clostridioides difficile E23] |
3.73e-07 | 95 | 43.636 | WP_009894739 |
hypothetical protein [Clostridioides difficile] hypothetical protein EGL80_17860 [Clostridioides difficile] hypothetical protein EGL78_16565 [Clostridioides difficile] hypothetical protein E5F45_10355 [Clostridioides difficile] hypothetical protein E5F38_16620 [Clostridioides difficile] hypothetical protein E5F27_10195 [Clostridioides difficile] |
3.84e-07 | 95 | 43.636 | WP_074068092 |
hypothetical protein SAMN05192546_11033 [Tindallia californiensis] |
3.99e-07 | 98 | 40.351 | SDZ15236 |
hypothetical protein CLOSYM_00894 [[Clostridium] symbiosum ATCC 14940] Uncharacterised protein [[Clostridium] symbiosum] |
4.86e-07 | 98 | 43.860 | ERI79462 |
Uncharacterised protein [Actinobacillus pleuropneumoniae] |
1.29e-06 | 93 | 46.296 | VTR22884 |
putative uncharacterized protein [Roseburia sp. CAG:309] |
1.77e-06 | 93 | 46.296 | CDD34750 |
hypothetical protein HMPREF9454_00545 [Megamonas funiformis YIT 11815] |
3.19e-06 | 93 | 42.593 | EHR38740 |
hypothetical protein BGU91_20180 [Clostridioides difficile] |
3.27e-06 | 95 | 41.818 | PBG33065 |
hypothetical protein [Clostridioides difficile] |
3.4e-06 | 95 | 41.818 | WP_096000610 |
hypothetical protein CDIF102859_01203 [Clostridioides difficile] hypothetical protein QUI_0283 [Clostridioides difficile P59] hypothetical protein BGV21_04170 [Clostridioides difficile] Uncharacterised protein [Clostridioides difficile] Uncharacterised protein [Clostridioides difficile] |
3.81e-06 | 93 | 42.593 | AXU27024 |
hypothetical protein [Clostridioides difficile] |
3.96e-06 | 93 | 42.593 | WP_074076078 |
ABC-type transport system,ATP-binding protein [Clostridioides difficile 630] ABC-type transport system,ATP-binding protein [Clostridioides difficile] |
7.47e-06 | 95 | 43.636 | CAJ69777 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_66 In anaero CP036345.1
Seq (len = 50 ):
MFVLPSVLLLFPHGSSAWRLRRKGNVYEDACRISRQCDSALPRCLYNGFI
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|160829|-1|3036963-3037116
Transkriptom
95.0% of gene length expressed over median expression of contig.
ŝ
2.72584215073632
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
ABC-type transport system,ATP-binding protein [Clostridioides difficile 630]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
conserved hypothetical protein [Natranaerobius thermophilus JW/NM-WN-LF] |
7.78e-16 | 97 | 58.929 | ACB84405 |
Uncharacterised protein [[Eubacterium] contortum] [Faecalicatena contorta] |
1.44e-13 | 95 | 58.182 | CUO70562 |
hypothetical protein [Firmicutes bacterium] |
6.88e-13 | 97 | 51.786 | MTI96807 |
hypothetical protein HMPREF0994_06176 [Lachnospiraceae bacterium 3_1_57FAA_CT1] hypothetical protein BEI61_01198 [Eisenbergiella tayi] Uncharacterised protein [Fusicatenibacter sp. 2789STDY5834925] |
3.34e-11 | 98 | 49.123 | EGN30669 |
hypothetical protein Cbu04g_08690 [Clostridium butyricum] hypothetical protein CBU03nite_26250 [Clostridium butyricum] |
8.27e-11 | 93 | 51.852 | BBK75861 |
Uncharacterised protein [Blautia wexlerae] |
1.37e-10 | 98 | 49.123 | CUP56275 |
hypothetical protein C817_03485 [Dorea sp. 5-2] |
1.93e-10 | 95 | 50.909 | EOS78962 |
hypothetical protein LX24_01078 [Desulfallas thermosapovorans DSM 6562] |
5.07e-10 | 97 | 46.429 | TYO96609 |
hypothetical protein HMPREF0988_02568 [Lachnospiraceae bacterium 1_4_56FAA] |
1.15e-09 | 95 | 49.091 | EGN35448 |
hypothetical protein DJ90_237 [Paenibacillus macerans] hypothetical protein PbDSM24746_11870 [Paenibacillus thermophilus] hypothetical protein PbJCM17693_11940 [Paenibacillus thermophilus] Uncharacterised protein [Paenibacillus macerans] |
1.16e-09 | 93 | 51.852 | KFN05636 |
Uncharacterised protein [uncultured Clostridium sp.] |
1.64e-09 | 93 | 50.000 | SCH14314 |
hypothetical protein EV209_1018 [Cuneatibacter caecimuris] |
2.35e-09 | 98 | 47.368 | RZT02888 |
hypothetical protein HMPREF0262_00421 [Clostridium sp. ATCC 29733] hypothetical protein SAMN05444424_2631 [Clostridium sp. DSM 4029] |
2.41e-09 | 98 | 49.123 | ERJ00832 |
hypothetical protein D7X25_14600 [bacterium 1XD42-8] hypothetical protein D7Y09_13905 [bacterium 1XD42-1] |
4.65e-08 | 97 | 44.643 | RKJ52565 |
hypothetical protein Clole_1881 [Cellulosilyticum lentocellum DSM 5427] |
1.04e-07 | 95 | 43.636 | ADZ83601 |
hypothetical protein [Clostridioides difficile] |
1.1e-07 | 95 | 45.455 | WP_077727208 |
Uncharacterised protein [Clostridioides difficile] |
1.21e-07 | 95 | 45.455 | SJW28021 |
conserved hypothetical protein [Clostridium perfringens C str. JGS1495] hypothetical protein HMPREF3222_00396 [Clostridium perfringens] |
1.55e-07 | 95 | 43.636 | EDS80572 |
hypothetical protein [Anaeromassilibacillus sp. An200] hypothetical protein B5F35_07935 [Anaeromassilibacillus sp. An200] |
1.67e-07 | 97 | 41.071 | WP_087239760 |
hypothetical protein [Clostridioides difficile] hypothetical protein CD630_09390 [Clostridioides difficile 630] hypothetical protein phiC2p82 [Clostridium virus phiC2] conserved hypothetical protein [Clostridium phage phiCDHM19] hypothetical protein CDBPCV119_gp74 [Clostridium virus phiCD119] hypothetical protein QC7_1137 [Clostridioides difficile CD38] hypothetical protein [Clostridium virus phiCD119] hypothetical protein phiC2p82 [Clostridium virus phiC2] hypothetical protein CWR55_16830 [Clostridioides difficile] hypothetical protein DDG63_14550 [Clostridioides difficile] |
3.44e-07 | 95 | 43.636 | WP_011861023 |
hypothetical protein [Alkalibaculum bacchi] hypothetical protein DES36_10384 [Alkalibaculum bacchi] |
3.67e-07 | 93 | 42.593 | WP_113919755 |
hypothetical protein QUW_0257 [Clostridioides difficile P72] hypothetical protein QUO_2925 [Clostridioides difficile P64] |
3.7e-07 | 95 | 43.636 | EQK23754 |
hypothetical protein [Clostridioides difficile] conserved protein of unknown function [Clostridium phage phiMMP01] conserved protein of unknown function [Clostridium phage phiMMP03] putative phage protein [Peptoclostridium phage p630P1] [Clostridioides difficile 630] hypothetical protein QCA_0949 [Clostridioides difficile CD40] hypothetical protein QC9_0862 [Clostridioides difficile CD39] hypothetical protein QCG_3205 [Clostridioides difficile CD43] hypothetical protein QCO_3320 [Clostridioides difficile CD47] hypothetical protein QCK_0995 [Clostridioides difficile CD45] hypothetical protein QCQ_1056 [Clostridioides difficile CD49] hypothetical protein QCY_0930 [Clostridioides difficile CD70] hypothetical protein QEK_3144 [Clostridioides difficile CD131] hypothetical protein QES_1111 [Clostridioides difficile CD149] hypothetical protein QEQ_0258 [Clostridioides difficile CD144] hypothetical protein QG1_3325 [Clostridioides difficile CD166] hypothetical protein QEI_0849 [Clostridioides difficile CD129] hypothetical protein QGA_3640 [Clostridioides difficile CD181] hypothetical protein QGE_3112 [Clostridioides difficile CD200] hypothetical protein QIE_0925 [Clostridioides difficile DA00062] hypothetical protein QIO_1239 [Clostridioides difficile DA00129] hypothetical protein QK3_1013 [Clostridioides difficile DA00145] hypothetical protein QKI_3181 [Clostridioides difficile DA00189] hypothetical protein QKU_3363 [Clostridioides difficile DA00203] hypothetical protein QKW_0969 [Clostridioides difficile DA00210] hypothetical protein QM9_0983 [Clostridioides difficile DA00238] hypothetical protein QMK_0893 [Clostridioides difficile DA00273] hypothetical protein QMO_0874 [Clostridioides difficile DA00305] hypothetical protein QMS_1003 [Clostridioides difficile DA00307] hypothetical protein QMY_3641 [Clostridioides difficile F152] hypothetical protein QMU_0919 [Clostridioides difficile DA00310] hypothetical protein QOO_0943 [Clostridioides difficile Y165] hypothetical protein QOS_2334 [Clostridioides difficile Y184] hypothetical protein QOU_0863 [Clostridioides difficile Y202] hypothetical protein QQ3_3081 [Clostridioides difficile Y266] hypothetical protein QQC_3286 [Clostridioides difficile Y358] hypothetical protein QQM_0917 [Clostridioides difficile P2] hypothetical protein QQW_3005 [Clostridioides difficile P8] hypothetical protein QS3_0257 [Clostridioides difficile P13] hypothetical protein QS7_0809 [Clostridioides difficile P19] hypothetical protein QS9_3190 [Clostridioides difficile P20] hypothetical protein QSG_1262 [Clostridioides difficile P25] hypothetical protein QSE_0925 [Clostridioides difficile P24] hypothetical protein QUE_0253 [Clostridioides difficile P51] hypothetical protein QUM_1045 [Clostridioides difficile P78] hypothetical protein QUS_0919 [Clostridioides difficile P69] hypothetical protein QW7_1013 [Clostridioides difficile P77] hypothetical protein C676_3490 [Clostridioides difficile F548] hypothetical protein QE7_3290 [Clostridioides difficile CD92] hypothetical protein QEE_1029 [Clostridioides difficile CD113] hypothetical protein QEC_0892 [Clostridioides difficile CD111] hypothetical protein QE1_1025 [Clostridioides difficile CD86] hypothetical protein QSS_0933 [Clostridioides difficile P33] hypothetical protein QUQ_0269 [Clostridioides difficile P68] Putative phage protein [Clostridioides difficile E10] Putative phage protein [Clostridioides difficile T22] Putative phage protein [Clostridioides difficile E25] Putative phage protein [Clostridioides difficile T15] Putative phage protein [Clostridioides difficile T11] Putative phage protein [Clostridioides difficile E15] Putative phage protein [Clostridioides difficile T42] Putative phage protein [Clostridioides difficile E9] Putative phage protein [Clostridioides difficile E7] Putative phage protein [Clostridioides difficile T3] Putative phage protein [Clostridioides difficile E23] |
3.73e-07 | 95 | 43.636 | WP_009894739 |
hypothetical protein [Clostridioides difficile] hypothetical protein EGL80_17860 [Clostridioides difficile] hypothetical protein EGL78_16565 [Clostridioides difficile] hypothetical protein E5F45_10355 [Clostridioides difficile] hypothetical protein E5F38_16620 [Clostridioides difficile] hypothetical protein E5F27_10195 [Clostridioides difficile] |
3.84e-07 | 95 | 43.636 | WP_074068092 |
hypothetical protein SAMN05192546_11033 [Tindallia californiensis] |
3.99e-07 | 98 | 40.351 | SDZ15236 |
hypothetical protein CLOSYM_00894 [[Clostridium] symbiosum ATCC 14940] Uncharacterised protein [[Clostridium] symbiosum] |
4.86e-07 | 98 | 43.860 | ERI79462 |
Uncharacterised protein [Actinobacillus pleuropneumoniae] |
1.29e-06 | 93 | 46.296 | VTR22884 |
putative uncharacterized protein [Roseburia sp. CAG:309] |
1.77e-06 | 93 | 46.296 | CDD34750 |
hypothetical protein HMPREF9454_00545 [Megamonas funiformis YIT 11815] |
3.19e-06 | 93 | 42.593 | EHR38740 |
hypothetical protein BGU91_20180 [Clostridioides difficile] |
3.27e-06 | 95 | 41.818 | PBG33065 |
hypothetical protein [Clostridioides difficile] |
3.4e-06 | 95 | 41.818 | WP_096000610 |
hypothetical protein CDIF102859_01203 [Clostridioides difficile] hypothetical protein QUI_0283 [Clostridioides difficile P59] hypothetical protein BGV21_04170 [Clostridioides difficile] Uncharacterised protein [Clostridioides difficile] Uncharacterised protein [Clostridioides difficile] |
3.81e-06 | 93 | 42.593 | AXU27024 |
hypothetical protein [Clostridioides difficile] |
3.96e-06 | 93 | 42.593 | WP_074076078 |
ABC-type transport system,ATP-binding protein [Clostridioides difficile 630] ABC-type transport system,ATP-binding protein [Clostridioides difficile] |
7.47e-06 | 95 | 43.636 | CAJ69777 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_67 In anaero CP036345.1
Seq (len = 29 ):
MISVTTGRPVAFLASSKSLSPSSWSPWKA
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|120583|1|3149038-3149347
Transkriptom
38.0% of gene length expressed over median expression of contig.
ŝ
2.0626493050903596
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_68 In lacto CP039121.1
Seq (len = 40 ):
LMTLGNDTPNNTKTIPFKILATIDQVVVITICSREVVNRN
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|53283|1|963419-963599
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.9010103605988227
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_69 In lacto CP039121.1
Seq (len = 21 ):
VKQIDSQSERPSITPKKSVSS
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|307604|-1|590125-590188
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0117384032712438
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_70 In blautia CP039126.1
Seq (len = 58 ):
MATKSIIKDVNIRDNKLCRTFASAIENASGRRGKDVQLSRSFKEISGEKIRELFGDKA
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|47691|1|1242045-1242297
Transkriptom
98.0% of gene length expressed over median expression of contig.
ŝ
3.9519468268843907
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_71 In blautia CP039126.1
Seq (len = 58 ):
MATKSIIKDVNIRDNKLCRTFASAIENASGRRGKDVQLSRSFKEISGEKIRELFGDKA
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|302523|-1|4177481-4177733
Transkriptom
98.0% of gene length expressed over median expression of contig.
ŝ
3.9519468268843907
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_72 In bact CP040530.1
Seq (len = 65 ):
MRCTALPVSLSVAHSGIHSITSVVITPIHTGEAFMTLSVRKSMRMKCSAANLRQASNIRWQNADR
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|327933|-1|4784808-4785033
Transkriptom
49.0% of gene length expressed over median expression of contig.
ŝ
1.7958800173440752
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_73 In clostri CP040626.1
Seq (len = 40 ):
IKGNVTFDTNKIGLTENIAIASAFCKAILFGNNSPKTKVI
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|156046|1|2127688-2127994
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
3.2170498667345875
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_74 In bact CP040530.1
Seq (len = 25 ):
VCREWAKAILSPATTQLPEENRIVV
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|217646|1|5069190-5069295
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.800336224300457
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 38 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_75 In anaero CP036345.1
Seq (len = 118 ):
MTFAPIAFRKSVCSINSFSVSSYGFEIRKLENQQLQISIPLNSRAFFNVFTSFGYFPPISDPVNPAKAISLTHCSKVFSLPRSGISSLVHPIGAIPNFTFFLSNISIITSFYNYSKFS
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|96399|1|2452073-2452445
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.9444942534907708
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_76 In lacto CP039121.1
Seq (len = 18 ):
TGGLHNNAGWLCNLEIVG
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|7055|1|122773-122827
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.8664610916297821
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_77 In lacto CP039121.1
Seq (len = 16 ):
MVIFLAVTAIKAAVPP
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|308341|-1|574924-575071
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.5489303066809055
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_78 In ecoli U00096.3
Seq (len = 34 ):
LARKSLSQPAPSRVTASQSAPSDRYKLLLFNGIG
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|177179|-1|4414306-4414414
Transkriptom
20.0% of gene length expressed over median expression of contig.
ŝ
1.9593976598859268
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 14 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_79 In clostri CP040626.1
Seq (len = 44 ):
LQNHYTFYLHFFLYLKFVFQQSLLHRYPNKLYKPLSYYLIPVQF
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|238164|1|3526124-3526268
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.6889528835784944
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_80 In bifi AE014295.3
Seq (len = 128 ):
MHKVSPPVKAVRCCTGHEPLGSVVVRLFGNAGAQLGKDFLFGFRTGVKLAQALVGLTDIVESGVDTVQFHTFDRCQQQSVHVELGKFAGDVVWLGGPTTGFPVDHGKACGGAGRVKSTDEYRIEFAID
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|22973|1|1055580-1056048
Transkriptom
49.0% of gene length expressed over median expression of contig.
ŝ
3.0591516125049254
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_81 In bact CP040530.1
Seq (len = 16 ):
MKAITTPTNILRKHSH
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|369752|-1|3769425-3769545
Transkriptom
26.0% of gene length expressed over median expression of contig.
ŝ
2.878440155812499
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{no overlap with annotation}
Candidate nov_psm6_82 In anaero CP036345.1
Seq (len = 19 ):
LSTRTAQEEKEQIVERKRS
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|18723|1|455953-456043
Transkriptom
30.0% of gene length expressed over median expression of contig.
ŝ
2.9465373950745444
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_83 In blautia CP039126.1
Seq (len = 33 ):
MTIHDPVLAVLCILFCKTPERTVTVQRLCGKYL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|238128|-1|5848233-5848338
Transkriptom
99.0% of gene length expressed over median expression of contig.
ŝ
2.243363891754152
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_84 In blautia CP039126.1
Seq (len = 325 ):
MVTAYALISQRRHTFSFQAHFCVCLCTGLHIIHHVPVHGTDAHLTAQSSLCKCDGRRREYVHILPLENRMAGYDHLHQQISSRAAIGSRFTLIPDTDTLSVVNTCRYRYLDLLSLVHVSGSAAVRAFVLDDLTGSVTFRTGLYISHHAEHGLLGVYHLAFPVAFRTGFRRSSRLCACSVTCITVFLQIQIQLFFTAKHCFLKCNADGCPHIGTFHRAVVGSSSSAAAKQIAENIAENITHISAVKSAEASKASCSAGTAVFKGRMAELVILSSLIRVTQNAVGLCSLLEFFLRFFVSGVYIRMVLLCQLTVCAFDRGVVSAFVHA
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|179496|1|4979215-4980325
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
3.005184450124933
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 19 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_85 In bifi AE014295.3
Seq (len = 121 ):
MVNAVEAFDAKHMKPAEEIPAFRPGDTVDVNVKIQEGNNSRIQTFTGVVIARKGAGVRETFVVRKISFGTGVERRFPVHSPSIDSIKLVRKGRVRRAKLYYLRALRGKAARIAERRDNSAK
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|74362|-1|1199449-1199821
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
5.0395292224657
unique PSMS
4
unique PSMS
4
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_86 In lacto CP039121.1
Seq (len = 30 ):
MTLEVVVHFRRHLLGSIGIKMLPTEVNCRI
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|216854|-1|2380743-2380884
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7594507517174
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
NAD-specific glutamate dehydrogenase [Cupriavidus sp. HMR-1]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
unknown [Blautia sp. CAG:37] |
1.06e-30 | 41 | 49.624 | CDE67036 |
unknown [Blautia sp. CAG:37] |
2.02e-29 | 52 | 40.237 | CDE67035 |
hypothetical protein NM95_2164 [Neisseria meningitidis NM95] |
3.45e-13 | 77 | 28.400 | EOC05185 |
hypothetical protein NM2008223_2159 [Neisseria meningitidis 2008223] |
3.13e-12 | 73 | 28.692 | EOC50107 |
hypothetical protein NM65014_2125 [Neisseria meningitidis 65014] hypothetical protein NM70082_2215 [Neisseria meningitidis 70082] |
3.01e-11 | 73 | 28.692 | ELL06229 |
hypothetical protein [Tanacetum cinerariifolium] |
2.54e-07 | 74 | 29.508 | GEU28124 |
NAD-specific glutamate dehydrogenase [Cupriavidus sp. HMR-1] |
1.36e-06 | 78 | 31.765 | ELA00912 |
putative NAD-specific glutamate dehydrogenase encoded in antisense gene pair with dnaKJ [Sphingomonas sp. SKA58] |
9.95e-06 | 83 | 26.642 | EAT08581 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_87 In lacto CP039121.1
Seq (len = 41 ):
HHAGVAELADALDLGSSVLRRGGSSPFTRTCRLSSVGRASH
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|216637|-1|2384851-2384974
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.009513149136029
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
50S ribosomal protein L19 [Bifidobacterium longum]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] Ribosomal protein L19 [Bifidobacterium longum DJO10A] ribosomal protein L19 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088] putative protein [uncultured organism] ribosomal protein L19 [Bifidobacterium longum subsp. longum JDM301] RplS [Bifidobacterium longum subsp. longum BBMN68] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum KACC 91563] 50S ribosomal protein L19 [Bifidobacterium longum subsp. infantis] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum] ribosomal protein L19 [Bifidobacterium longum subsp. longum ATCC 55813] ribosomal protein L19 [Bifidobacterium longum subsp. infantis CCUG 52486] ribosomal protein L19 [Bifidobacterium longum subsp. longum 35B] ribosomal protein L19 [Bifidobacterium longum subsp. longum 1-6B] ribosomal protein L19 [Bifidobacterium longum subsp. longum 2-2B] ribosomal protein L19 [Bifidobacterium longum subsp. longum 44B] LSU ribosomal protein L19p [Bifidobacterium longum D2957] LSU ribosomal protein L19 [Bifidobacterium longum E18] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum 1-5B] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum 17-1B] 50S ribosomal protein L19 [Bifidobacterium longum subsp. infantis EK3] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum 72B] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum EK5] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum EK13] 50S ribosomal protein L19 [Bifidobacterium longum subsp. suis] LSU ribosomal protein L19P [Bifidobacterium longum subsp. longum F8] ribosomal protein L19 [Bifidobacterium longum subsp. longum CECT 7347] putative uncharacterized protein [Bifidobacterium longum CAG:69] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum JCM 1217] 50S ribosomal protein L19 [Bifidobacterium longum subsp. infantis 157F] |
8.85e-81 | 100 | 100.000 | WP_007051394 |
50S ribosomal protein L19 [Bifidobacterium longum] LSU ribosomal protein L19P [Bifidobacterium longum subsp. longum] |
2.74e-80 | 100 | 99.174 | WP_131206330 |
50S ribosomal protein L19 [Bifidobacterium longum] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum 7-1B] |
2.74e-80 | 100 | 99.174 | WP_032738780 |
50S ribosomal protein L19 [Bifidobacterium longum] LSU ribosomal protein L19P [Bifidobacterium longum subsp. longum] |
2.74e-80 | 100 | 99.174 | WP_131232524 |
50S ribosomal protein L19 [Bifidobacterium longum] |
4.8e-80 | 100 | 99.174 | WP_138266946 |
50S ribosomal protein L19 [Bifidobacterium longum] 50S ribosomal protein L19 [Bifidobacterium longum subsp. longum GT15] |
1.59e-79 | 100 | 99.174 | WP_038426297 |
LSU ribosomal protein L19P [Bifidobacterium breve JCM 7019] |
3.03e-79 | 100 | 96.694 | AHJ18690 |
LSU ribosomal protein L19P [Bifidobacterium breve] 50S ribosomal protein L19 [Bifidobacterium breve CECT 7263] LSU ribosomal protein L19P [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve] |
3.35e-79 | 100 | 96.694 | AUD68555 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] ribosomal protein L19 [Bifidobacterium reuteri DSM 23975] 50S ribosomal protein L19 [Bifidobacterium reuteri] 50S ribosomal protein L19 [Bifidobacterium sp. UTCIF-1] 50S ribosomal protein L19 [Bifidobacterium sp. UTCIF-24] 50S ribosomal protein L19 [Bifidobacterium sp. UTCIF-3] |
4.61e-79 | 100 | 96.694 | WP_044089563 |
50S ribosomal protein L19 [Escherichia coli] 50S ribosomal protein L19 [Escherichia coli] |
5.37e-79 | 100 | 98.347 | WP_154348258 |
50S ribosomal protein L19 [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve NCFB 2258] 50S ribosomal protein L19 [Bifidobacterium breve HPH0326] 50S ribosomal protein L19 [Bifidobacterium breve MCC 0476] 50S ribosomal protein L19 [Bifidobacterium breve MCC 0121] 50S ribosomal protein L19 [Bifidobacterium breve MCC 1340] 50S ribosomal protein L19 [Bifidobacterium breve MCC 0305] 50S ribosomal protein L19 [Bifidobacterium breve MCC 1605] |
5.37e-79 | 100 | 96.694 | WP_016462247 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium myosotis] 50S ribosomal protein L19 [Bifidobacterium myosotis] 50S ribosomal protein L19 [Bifidobacterium sp. UTBIF-78] |
5.74e-79 | 100 | 96.694 | WP_094667001 |
50S ribosomal protein L19 [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve 31L] 50S ribosomal protein L19 [Bifidobacterium breve MCC 1128] 50S ribosomal protein L19 [Bifidobacterium breve] 50S ribosomal protein L19 [Bifidobacterium breve] |
8.06e-79 | 100 | 95.868 | WP_042993937 |
LSU ribosomal protein L19P [Bifidobacterium breve] ribosomal protein L19 [Bifidobacterium breve DSM 20213 = JCM 1192] LSU ribosomal protein L19P [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve] |
1.08e-78 | 100 | 95.868 | AUD66580 |
LSU ribosomal protein L19P [Bifidobacterium breve] |
1.32e-78 | 100 | 95.868 | AUD88558 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] LSU ribosomal protein L19P [Bifidobacterium breve UCC2003] ribosomal protein L19 [Bifidobacterium breve ACS-071-V-Sch8b] LSU ribosomal protein L19P [Bifidobacterium breve JCM 7017] 50S ribosomal protein L19 [Bifidobacterium breve MCC 1094] 50S ribosomal protein L19 [Bifidobacterium breve MCC 1454] 50S ribosomal protein L19 [Bifidobacterium breve DSM 20213 = JCM 1192] |
1.86e-78 | 100 | 95.868 | WP_014483482 |
LSU ribosomal protein L19P [Bifidobacterium breve 689b] LSU ribosomal protein L19P [Bifidobacterium breve] ribosomal protein L19 [Bifidobacterium breve JCP7499] LSU ribosomal protein L19P [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve] |
2.21e-78 | 100 | 95.041 | AHJ22471 |
50S ribosomal protein L19 [Bifidobacterium breve] LSU ribosomal protein L19P [Bifidobacterium breve 12L] LSU ribosomal protein L19P [Bifidobacterium breve S27] LSU ribosomal protein L19P [Bifidobacterium breve 2L] 50S ribosomal protein L19 [Bifidobacterium breve MCC 1604] 50S ribosomal protein L19 [Bifidobacterium breve MCC 1114] |
2.64e-78 | 100 | 95.041 | WP_025299562 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium saguini DSM 23967] 50S ribosomal protein L19 [Bifidobacterium sp. LMG 31469] 50S ribosomal protein L19 [Bifidobacterium felsineum] 50S ribosomal protein L19 [Bifidobacterium scaligerum] 50S ribosomal protein L19 [Bifidobacterium imperatoris] |
4.57e-78 | 100 | 95.868 | WP_033891529 |
50S ribosomal protein L19 [Bifidobacterium callitrichidarum] 50S ribosomal protein L19 [Bifidobacterium callitrichidarum] |
8.26e-78 | 100 | 95.868 | WP_109057646 |
50S ribosomal protein L19 [Gardnerella vaginalis] 50S ribosomal protein L19 [Gardnerella vaginalis] |
2.15e-77 | 100 | 95.041 | WP_103084577 |
ribosomal protein L19 [Bifidobacterium gallicum DSM 20093 = LMG 11596] |
3.02e-77 | 100 | 94.215 | EFA23322 |
50S ribosomal protein L19 [Bifidobacterium gallicum] 50S ribosomal protein L19 [Bifidobacterium gallicum DSM 20093 = LMG 11596] |
4.01e-77 | 100 | 94.215 | WP_044085170 |
MULTISPECIES: 50S ribosomal protein L19 [Gardnerella] ribosomal protein L19 [Gardnerella vaginalis] 50S ribosomal protein L19 [Gardnerella sp. KA00735] |
4.94e-77 | 100 | 94.215 | WP_075523582 |
50S ribosomal protein L19 [Bifidobacterium bifidum] 50S ribosomal protein L19 [Bifidobacterium bifidum] |
6.03e-77 | 100 | 93.388 | WP_116868502 |
MULTISPECIES: 50S ribosomal protein L19 [Terrabacteria group] ribosomal protein L19 [Gardnerella vaginalis 409-05] ribosomal protein L19 [Gardnerella vaginalis AMD] ribosomal protein L19 [Gardnerella vaginalis 5-1] 50S ribosomal protein L19 [Gardnerella vaginalis 6420B] 50S ribosomal protein L19 [Bifidobacteriaceae bacterium NR015] 50S ribosomal protein L19 [Bifidobacteriaceae bacterium WP022] |
6.8e-77 | 100 | 94.215 | WP_004105329 |
50S ribosomal protein L19 [Bifidobacterium bifidum] 50S ribosomal protein L19 [Bifidobacterium bifidum PRL2010] rplS LSU ribosomal protein L19P [Bifidobacterium bifidum S17] ribosomal protein L19 [Bifidobacterium bifidum BGN4] ribosomal protein L19 [Bifidobacterium bifidum NCIMB 41171] 50S ribosomal protein L19 [Bifidobacterium bifidum LMG 13195] 50S ribosomal protein L19 [Bifidobacterium bifidum IPLA 20015] ribosomal protein L19 [Bifidobacterium bifidum ATCC 29521 = JCM 1255 = DSM 20456] 50S ribosomal protein L19 [Bifidobacterium sp. 56_9_plus] 50S ribosomal protein L19 [Bifidobacterium bifidum CAG:234] |
7.1e-77 | 100 | 93.388 | WP_003811942 |
50S ribosomal protein L19, partial [Bifidobacterium longum] 50S ribosomal protein L19, partial [Bifidobacterium longum] |
7.84e-77 | 96 | 100.000 | WP_115768859 |
50S ribosomal protein L19 [Bifidobacterium scardovii] 50S ribosomal protein L19 [Bifidobacterium scardovii] 50S ribosomal protein L19 [Bifidobacterium scardovii JCM 12489 = DSM 13734] |
1.37e-76 | 100 | 94.215 | WP_033519811 |
50S ribosomal protein L19 [Bifidobacterium ramosum] 50S ribosomal protein L19 [Bifidobacterium ramosum] |
1.97e-76 | 100 | 93.388 | WP_152357836 |
50S ribosomal protein L19 [Gardnerella vaginalis] ribosomal protein L19 [Gardnerella vaginalis HMP9231] ribosomal protein L19 [Gardnerella vaginalis 315-A] 50S ribosomal protein L19 [Gardnerella vaginalis 284V] 50S ribosomal protein L19 [Gardnerella vaginalis 75712] 50S ribosomal protein L19 [Gardnerella vaginalis 0288E] 50S ribosomal protein L19 [Gardnerella vaginalis 55152] 50S ribosomal protein L19 [Gardnerella vaginalis 1400E] 50S ribosomal protein L19 [Gardnerella vaginalis ATCC 14018 = JCM 11026] 50S ribosomal protein L19 [Chlamydia trachomatis] |
2.2e-76 | 99 | 94.167 | WP_004114457 |
MULTISPECIES: 50S ribosomal protein L19 [Terrabacteria group] 50S ribosomal protein L19 [Gardnerella vaginalis 00703Bmash] 50S ribosomal protein L19 [Gardnerella vaginalis 1500E] 50S ribosomal protein L19 [Gardnerella vaginalis 00703C2mash] 50S ribosomal protein L19 [Gardnerella vaginalis 00703Dmash] 50S ribosomal protein L19 [Gardnerella vaginalis 6119V5] ribosomal protein L19 [Gardnerella vaginalis JCP7719] ribosomal protein L19 [Gardnerella vaginalis JCP8017A] ribosomal protein L19 [Gardnerella vaginalis JCP7659] ribosomal protein L19 [Gardnerella vaginalis JCP8017B] 50S ribosomal protein L19 [Bifidobacteriaceae bacterium GH022] 50S ribosomal protein L19 [Bifidobacteriaceae bacterium NR003] |
2.43e-76 | 99 | 94.167 | WP_004127473 |
ribosomal protein L19 [Gardnerella vaginalis JCP8522] ribosomal protein L19 [Gardnerella vaginalis JCP8151B] ribosomal protein L19 [Gardnerella vaginalis JCP8151A] ribosomal protein L19 [Gardnerella vaginalis JCP8070] ribosomal protein L19 [Gardnerella vaginalis JCP8066] |
2.78e-76 | 99 | 94.167 | EPI41002 |
50S ribosomal protein L19 [Bifidobacterium sp. LMG 31471] 50S ribosomal protein L19 [Bifidobacterium sp. LMG 31471] |
3.2e-76 | 100 | 92.562 | WP_152234441 |
50S ribosomal protein L19 [Bifidobacterium bifidum] |
3.36e-76 | 100 | 93.388 | KLN87876 |
50S ribosomal protein L19 [Gardnerella vaginalis] 50S ribosomal protein L19 [Gardnerella vaginalis ATCC 14019] ribosomal protein L19 [Gardnerella vaginalis JCP8108] ribosomal protein L19 [Gardnerella vaginalis JCP7672] ribosomal protein L19 [Gardnerella vaginalis JCP7276] ribosomal protein L19 [Gardnerella vaginalis JCP7275] ribosomal protein L19 [Gardnerella vaginalis ATCC 14019] |
4.39e-76 | 99 | 94.167 | WP_013399747 |
50S ribosomal protein L19 [Bifidobacterium dolichotidis] 50S ribosomal protein L19 [Bifidobacterium dolichotidis] |
4.49e-76 | 100 | 93.388 | WP_125963749 |
50S ribosomal protein L19 [Gardnerella vaginalis] ribosomal protein L19 [Gardnerella vaginalis JCP8481A] ribosomal protein L19 [Gardnerella vaginalis JCP8481B] |
4.64e-76 | 99 | 93.333 | WP_016636700 |
ribosomal protein L19 [Gardnerella vaginalis] |
6.19e-76 | 99 | 94.167 | KXA17673 |
50S ribosomal protein L19 [Bifidobacterium criceti] 50S ribosomal protein L19 [Bifidobacterium criceti] |
7.77e-76 | 100 | 92.562 | WP_095614831 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium lemurum] 50S ribosomal protein L19 [Bifidobacterium eulemuris] |
9.68e-76 | 100 | 92.562 | WP_072723454 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium gallinarum] 50S ribosomal protein L19 [Bifidobacterium pullorum] 50S ribosomal protein L19 [Bifidobacterium saeculare DSM 6531 = LMG 14934] 50S ribosomal protein L19 [Bifidobacterium gallinarum] |
1.29e-75 | 99 | 93.333 | WP_033505372 |
50S ribosomal protein L19 [Bifidobacterium goeldii] 50S ribosomal protein L19 [Bifidobacterium goeldii] |
2.21e-75 | 100 | 90.909 | WP_125980043 |
50S ribosomal protein L19 [Bifidobacterium samirii] 50S ribosomal protein L19 [Bifidobacterium samirii] |
2.49e-75 | 100 | 92.562 | WP_125968621 |
50S ribosomal protein L19 [Gardnerella vaginalis] 50S ribosomal protein L19 [Gardnerella vaginalis] |
3.65e-75 | 99 | 93.333 | PZO99057 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium sp. N5G01] 50S ribosomal protein L19 [Bifidobacterium sp. N4G05] 50S ribosomal protein L19 [Bifidobacterium catenulatum] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] |
5.42e-75 | 100 | 92.562 | WP_099571022 |
50S ribosomal protein L19 [Bifidobacterium biavatii] 50S ribosomal protein L19 [Bifidobacterium biavatii DSM 23969] |
6.76e-75 | 100 | 92.562 | WP_033494544 |
50S ribosomal protein L19 [Bifidobacterium cuniculi] ribosomal protein L19 [Bifidobacterium cuniculi] |
9.49e-75 | 100 | 90.909 | WP_033516258 |
50S ribosomal protein L19 [Bifidobacterium apri] 50S ribosomal protein L19 [Bifidobacterium apri] |
1.98e-74 | 100 | 90.909 | WP_152355888 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] rplS LSU ribosomal protein L19P [Bifidobacterium dentium Bd1] ribosomal protein L19 [Bifidobacterium dentium ATCC 27678] ribosomal protein L19 [Bifidobacterium dentium ATCC 27679] ribosomal protein L19 [Bifidobacterium dentium JCVIHMP022] large subunit ribosomal protein L19 [Bifidobacterium dentium JCM 1195 = DSM 20436] |
2.63e-74 | 100 | 91.736 | WP_003837538 |
50S ribosomal protein L19 [Bifidobacterium moukalabense] 50S ribosomal protein L19P [Bifidobacterium moukalabense DSM 27321] |
2.69e-74 | 100 | 90.909 | WP_034876535 |
50S ribosomal protein L19 [Bifidobacterium vespertilionis] 50S ribosomal protein L19 [Bifidobacterium vespertilionis] 50S ribosomal protein L19 [Bifidobacterium vespertilionis] |
3.91e-74 | 99 | 92.500 | WP_150354878 |
50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] |
4.27e-74 | 100 | 91.736 | WP_117789419 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium thermophilum RBL67] 50S ribosomal protein L19 [Bifidobacterium thermacidophilum subsp. porcinum] 50S ribosomal protein L19 [Bifidobacterium thermacidophilum subsp. thermacidophilum] 50S ribosomal protein L19 [Bifidobacterium thermophilum] 50S ribosomal protein L19 [Bifidobacterium thermophilum] |
4.56e-74 | 100 | 90.083 | WP_015449855 |
50S ribosomal protein L19 [Bifidobacterium boum] 50S ribosomal protein L19 [Bifidobacterium boum] |
5.26e-74 | 100 | 90.083 | WP_026503410 |
50S ribosomal protein L19 [Bifidobacterium jacchi] 50S ribosomal protein L19 [Bifidobacterium jacchi] |
7.64e-74 | 100 | 90.909 | WP_151916285 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] ribosomal protein L19 [Bifidobacterium pseudocatenulatum DSM 20438 = JCM 1200 = LMG 10505] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum IPLA36007] 50S ribosomal protein L19 [Bifidobacterium catenulatum subsp. kashiwanohense JCM 15439 = DSM 21854] 50S ribosomal protein L19 [Bifidobacterium catenulatum subsp. kashiwanohense] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum CAG:263] |
1.28e-73 | 100 | 90.909 | WP_004220134 |
50S ribosomal protein L19 [Bifidobacterium thermophilum] |
1.31e-73 | 100 | 89.256 | KFJ07001 |
50S ribosomal protein L19 [Bifidobacterium thermophilum] |
1.49e-73 | 100 | 89.256 | WP_033493840 |
50S ribosomal protein L19 [Bifidobacterium adolescentis] RecName: Full=50S ribosomal protein L19 [Bifidobacterium adolescentis ATCC 15703] 50S ribosomal protein L19 [Bifidobacterium adolescentis CAG:119] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] |
2.17e-73 | 100 | 90.083 | WP_021912811 |
putative 50S ribosomal protein L19 [Bifidobacterium adolescentis ATCC 15703] |
2.26e-73 | 100 | 90.083 | BAF39013 |
50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] 50S ribosomal protein L19 [Bifidobacterium pseudocatenulatum] |
2.29e-73 | 100 | 90.083 | WP_117661020 |
50S ribosomal protein L19 [Bifidobacterium pseudolongum] 50S ribosomal protein L19 [Bifidobacterium pseudolongum PV8-2] 50S ribosomal protein L19 [Bifidobacterium pseudolongum subsp. globosum DSM 20092] ribosomal protein L19 [Bifidobacterium pseudolongum subsp. pseudolongum] 50S ribosomal protein L19 [Bifidobacterium pseudolongum subsp. globosum] ribosomal protein L19 [Bifidobacterium pseudolongum] |
3.04e-73 | 100 | 88.430 | WP_022858343 |
50S ribosomal protein L19 [Bifidobacterium catenulatum] 50S ribosomal protein L19 [Bifidobacterium kashiwanohense PV20-2] |
4.28e-73 | 100 | 90.083 | WP_039196924 |
50S ribosomal protein L19 [Bifidobacterium sp.] |
6.49e-73 | 100 | 88.430 | HCA73964 |
50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium sp.] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] |
7.09e-73 | 100 | 89.256 | WP_038444004 |
50S ribosomal protein L19 [Bifidobacterium stellenboschense] 50S ribosomal protein L19 [Bifidobacterium stellenboschense] |
7.25e-73 | 96 | 93.966 | WP_034530228 |
50S ribosomal protein L19 [Bifidobacterium adolescentis] ribosomal protein L19 [Bifidobacterium adolescentis L2-32] putative 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] |
7.33e-73 | 100 | 90.083 | WP_003807720 |
50S ribosomal protein L19 [Bifidobacterium catenulatum] ribosomal protein L19 [Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043] 50S ribosomal protein L19 [Bifidobacteriales bacterium 56_10] 50S ribosomal protein L19 [Bifidobacterium catenulatum] 50S ribosomal protein L19 [Bifidobacterium catenulatum] 50S ribosomal protein L19 [Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043] |
8.27e-73 | 100 | 89.256 | WP_003836149 |
50S ribosomal protein L19 [Bifidobacterium hapali] 50S ribosomal protein L19 [Bifidobacterium hapali] |
1.12e-72 | 100 | 87.603 | WP_094729614 |
50S ribosomal protein L19 [Bifidobacterium tibiigranuli] 50S ribosomal protein L19 [Bifidobacterium tibiigranuli] 50S ribosomal protein L19 [Bifidobacterium tibiigranuli] |
1.48e-72 | 100 | 87.603 | WP_152580634 |
50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium stercoris JCM 15918] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] |
1.51e-72 | 100 | 88.430 | WP_033499339 |
50S ribosomal protein L19 [Bifidobacterium aesculapii] |
1.78e-72 | 96 | 93.103 | WP_055427703 |
50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] |
2.4e-72 | 100 | 89.256 | WP_151905383 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium rousetti] 50S ribosomal protein L19 [Bifidobacterium callitrichos] |
2.83e-72 | 96 | 92.241 | WP_107040675 |
50S ribosomal protein L19 [Bifidobacterium subtile] 50S ribosomal protein L19 [Bifidobacterium subtile] |
2.89e-72 | 100 | 87.603 | WP_024464656 |
50S ribosomal protein L19 [Bifidobacterium tsurumiense] 50S ribosomal protein L19 [Bifidobacterium tsurumiense] 50S ribosomal protein L19 [Bifidobacterium tsurumiense] |
3.12e-72 | 100 | 88.430 | WP_026642831 |
50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] 50S ribosomal protein L19 [Bifidobacterium adolescentis] |
4.79e-72 | 100 | 88.430 | WP_085381645 |
50S ribosomal protein L19 [Bifidobacterium ruminantium] 50S ribosomal protein L19 [Bifidobacterium ruminantium] |
6.23e-72 | 100 | 88.430 | WP_026647070 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium callitrichos DSM 23973] 50S ribosomal protein L19 [Bifidobacterium callitrichos] 50S ribosomal protein L19 [Bifidobacterium callitrichos] 50S ribosomal protein L19 [Bifidobacterium sp. UTCIF-37] 50S ribosomal protein L19 [Bifidobacterium sp. UTCIF-38] |
1.02e-71 | 96 | 92.241 | WP_043166952 |
50S ribosomal protein L19 [Bifidobacterium parmae] 50S ribosomal protein L19 [Bifidobacterium parmae] |
2.38e-71 | 96 | 92.241 | WP_101622599 |
50S ribosomal protein L19 [Bifidobacterium primatium] 50S ribosomal protein L19 [Bifidobacterium primatium] |
4.35e-70 | 100 | 86.777 | WP_100510581 |
50S ribosomal protein L19 [Bifidobacterium magnum] 50S ribosomal protein L19 [Bifidobacterium magnum] |
8.32e-70 | 96 | 89.655 | WP_022859988 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium vansinderenii] 50S ribosomal protein L19 [Bifidobacterium callimiconis] |
8.4e-70 | 100 | 85.950 | WP_093960577 |
50S ribosomal protein L19 [Bifidobacterium catulorum] 50S ribosomal protein L19 [Bifidobacterium catulorum] |
1.98e-69 | 100 | 85.124 | WP_109138159 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium italicum] 50S ribosomal protein L19 [Bifidobacterium anseris] 50S ribosomal protein L19 [Bifidobacterium castoris] |
3.46e-69 | 100 | 92.562 | WP_026644690 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] ribosomal protein L19 [Bifidobacterium animalis subsp. lactis AD011] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis Bl-04] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis DSM 10140] LSU ribosomal protein L19P [Bifidobacterium animalis subsp. lactis BB-12] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis V9] LSU ribosomal protein L19P [Bifidobacterium animalis subsp. lactis CNCM I-2494] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis BLC1] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. animalis ATCC 25527] LSU ribosomal protein L19p [Bifidobacterium animalis subsp. lactis B420] LSU ribosomal protein L19p [Bifidobacterium animalis subsp. lactis Bi-07] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis Bl12] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis ATCC 27673] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis KLDS2.0603] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. animalis] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis HN019] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis BS 01] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis ATCC 27536] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. animalis MCC 0483] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. lactis ATCC 27674] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. animalis ATCC 27672] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. animalis MCC 0499] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. animalis MCC 1489] 50S ribosomal protein L19 [Bifidobacterium animalis subsp. animalis IM386] |
4.81e-69 | 100 | 91.736 | WP_004268407 |
50S ribosomal protein L19 [Bifidobacterium simiarum] 50S ribosomal protein L19 [Bifidobacterium simiarum] |
6.4e-69 | 100 | 85.950 | WP_100513630 |
MULTISPECIES: 50S ribosomal protein L19 [Bifidobacterium] 50S ribosomal protein L19 [Bifidobacterium tissieri] 50S ribosomal protein L19 [Bifidobacterium tissieri] 50S ribosomal protein L19 [Bifidobacterium tissieri] 50S ribosomal protein L19 [Bifidobacterium sp. UTCIF-39] |
1.26e-68 | 100 | 84.298 | WP_094662163 |
50S ribosomal protein L19 [Bifidobacterium aemilianum] 50S ribosomal protein L19 [Bifidobacterium aemilianum] |
1.83e-68 | 100 | 82.645 | WP_113860517 |
50S ribosomal protein L19 [Bifidobacterium bombi] 50S ribosomal protein L19 [Bifidobacterium bombi DSM 19703] |
7.39e-68 | 100 | 81.818 | WP_044087290 |
50S ribosomal protein L19 [Bifidobacterium sp. GSD1FS] 50S ribosomal protein L19 [Bifidobacterium sp. GSD1FS] |
7.9e-68 | 100 | 90.909 | WP_155588540 |
MULTISPECIES: 50S ribosomal protein L19 [Alloscardovia] |
1.58e-67 | 100 | 82.645 | WP_148130854 |
50S ribosomal protein L19 [Bifidobacterium choerinum] 50S ribosomal protein L19 [Bifidobacterium choerinum] 50S ribosomal protein L19 [Bifidobacterium choerinum] |
2.05e-67 | 100 | 89.256 | WP_024541066 |
50S ribosomal protein L19 [Bifidobacterium margollesii] 50S ribosomal protein L19 [Bifidobacterium margollesii] |
3.18e-67 | 100 | 83.471 | WP_101614802 |
ribosomal protein L19 [Alloscardovia omnicolens] |
1.23e-66 | 100 | 81.818 | KWZ75727 |
50S ribosomal protein L19 [Alloscardovia macacae] 50S ribosomal protein L19 [Alloscardovia macacae] 50S ribosomal protein L19 [Alloscardovia macacae] ribosomal protein L19 [Alloscardovia macacae] |
1.56e-66 | 99 | 82.500 | WP_086106453 |
50S ribosomal protein L19 [Alloscardovia omnicolens] 50S ribosomal protein L19 [Alloscardovia sp. HMSC034E08] 50S ribosomal protein L19 [Alloscardovia omnicolens] 50S ribosomal protein L19 [Alloscardovia omnicolens] |
1.88e-66 | 99 | 82.500 | WP_022857035 |
ribosomal protein L19 [Alloscardovia omnicolens F0580] |
1.97e-66 | 99 | 82.500 | ERH29591 |
50S ribosomal protein L19 [Bifidobacterium angulatum] 50S ribosomal protein L19 [Bifidobacterium angulatum] |
3.64e-66 | 98 | 91.597 | WP_045920850 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_88 In lacto CP039121.1
Seq (len = 7 ):
IVDLLAH
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|146765|1|2781956-2781995
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.079354998593212
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{no overlap with annotation}
Candidate nov_psm6_89 In clostri CP040626.1
Seq (len = 29 ):
MNFHLKQNRILKLQFNILKIFYNNVFINK
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|230042|1|3390851-3391037
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.6383351097730676
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_90 In blautia CP039126.1
Seq (len = 46 ):
IQLCLAVVPGTHMKTLEQGAAGQLRRKNSGHVNTAPQKGGTPFQAF
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|369692|-1|2373486-2373642
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.877347315573274
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein C5L25_001399 [Lactobacillus silagei JCM 19001] |
7.04e-11 | 71 | 100.000 | TDG70209 |
conserved hypothetical protein [Bacillus sp. 349Y] |
1.61e-07 | 88 | 78.378 | VXB93948 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_91 In bifi AE014295.3
Seq (len = 48 ):
PPNARPEPTTRWQGTMMVTGLRFTAPPTACAAMRPPPRRSANSAASSP
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|72849|-1|1265220-1265364
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.699694432330351
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_92 In lacto CP039121.1
Seq (len = 40 ):
ATQPRSQFVRTDFFLTMPPLKSLIKITNFPYDTSRVINCN
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|95405|1|1754982-1755102
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.9297157950521724
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
unnamed protein product
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
unnamed protein product |
2.6e-65 | 100 | 100.000 | WP_018597185 |
Rpn family recombination-promoting nuclease/putative transposase [Clostridiales bacterium VE202-06] |
2.06e-59 | 100 | 94.175 | WP_029470959 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia coccoides] putative transposase/invertase (TIGR01784 family) [Blautia coccoides] PD-(D/E)XK nuclease family transposase [Blautia coccoides] |
2.15e-59 | 100 | 94.175 | WP_115624014 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia producta] |
1.78e-53 | 100 | 85.859 | WP_033141722 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Blautia] hypothetical protein C3R19_17560 [Blautia producta] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. OF01-4LB] Rpn family recombination-promoting nuclease/putative transposase [Blautia sp. AF13-16] |
2.41e-44 | 100 | 83.495 | WP_103732429 |
hypothetical protein PMF13cell1_01642 [Blautia producta] |
8.91e-44 | 100 | 83.495 | QBE96104 |
Rpn family recombination-promoting nuclease/putative transposase [Blautia producta] |
1.47e-43 | 100 | 82.524 | WP_148391787 |
Rpn family recombination-promoting nuclease/putative transposase [Hungatella hathewayi] Rpn family recombination-promoting nuclease/putative transposase [Hungatella hathewayi] |
4.8e-40 | 100 | 64.486 | WP_025654606 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena contorta] Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena contorta] |
5.03e-39 | 99 | 66.667 | WP_153921891 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
1.45e-38 | 100 | 61.261 | WP_109731066 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena contorta] |
2.86e-38 | 100 | 63.551 | WP_055154878 |
PD-(D/E)XK nuclease family transposase [[Eubacterium] contortum] [Faecalicatena contorta] |
4.01e-38 | 100 | 63.551 | CUP06988 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiales] Rpn family recombination-promoting nuclease/putative transposase [Clostridium sp. AF19-22AC] |
7.98e-38 | 100 | 60.360 | WP_118620131 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [unclassified Eubacterium] Rpn family recombination-promoting nuclease/putative transposase [Eubacterium sp. BIOML-A1] Rpn family recombination-promoting nuclease/putative transposase [Eubacterium sp. BIOML-A2] Rpn family recombination-promoting nuclease/putative transposase [Eubacterium sp. am_0171] |
1.17e-37 | 100 | 62.617 | WP_129879253 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiales] |
1.66e-37 | 100 | 62.617 | WP_050642747 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
9.5e-37 | 100 | 57.391 | WP_109730648 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
2.49e-36 | 99 | 56.780 | WP_109730647 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
2.56e-36 | 100 | 54.472 | WP_109730778 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
2.78e-36 | 100 | 55.462 | WP_109732508 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiales] Rpn family recombination-promoting nuclease/putative transposase [Clostridium sp. AF19-22AC] |
3.46e-36 | 99 | 57.895 | WP_118619857 |
Rpn family recombination-promoting nuclease/putative transposase, partial [Clostridium sp. AF19-22AC] Rpn family recombination-promoting nuclease/putative transposase, partial [Clostridium sp. AF19-22AC] |
9.35e-36 | 100 | 51.145 | WP_118621930 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
1.15e-35 | 99 | 59.434 | WP_109731733 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiales] Rpn family recombination-promoting nuclease/putative transposase [Clostridium sp. AF19-22AC] |
4.68e-35 | 100 | 52.756 | WP_118619855 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
1.25e-34 | 100 | 48.921 | WP_109733246 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiales] Rpn family recombination-promoting nuclease/putative transposase [Clostridium sp. AF19-22AC] |
1.99e-34 | 100 | 52.101 | WP_118620649 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
2.57e-34 | 100 | 50.394 | WP_109732035 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiales] Rpn family recombination-promoting nuclease/putative transposase [Clostridium sp. AF19-22AC] |
2.27e-32 | 100 | 48.855 | WP_118621934 |
Rpn family recombination-promoting nuclease/putative transposase, partial [Clostridium sp. AF19-22AC] Rpn family recombination-promoting nuclease/putative transposase, partial [Clostridium sp. AF19-22AC] |
5.98e-31 | 90 | 53.982 | WP_118622232 |
hypothetical protein [Lachnospiraceae bacterium MD308] |
6.46e-30 | 99 | 50.000 | WP_044904542 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
7.18e-30 | 100 | 44.755 | WP_109732758 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein DWX43_22930 [Clostridium sp. AF19-22AC] |
4.77e-29 | 100 | 43.750 | WP_118622048 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] hypothetical protein C824_04048 [Schaedlerella arabinosiphila] |
2.46e-27 | 99 | 50.000 | WP_004082911 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] |
7.04e-27 | 99 | 49.123 | WP_125129065 |
hypothetical protein C824_00797 [Schaedlerella arabinosiphila] |
9.81e-27 | 99 | 45.385 | EMZ32147 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] |
1.31e-26 | 99 | 48.305 | WP_125129062 |
hypothetical protein C824_04967 [Schaedlerella arabinosiphila] |
1.86e-26 | 99 | 49.153 | EMZ22295 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] |
2.1e-25 | 99 | 45.238 | WP_125126491 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] |
3.18e-25 | 99 | 47.541 | WP_125126478 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] |
9.87e-25 | 99 | 43.846 | WP_125126490 |
hypothetical protein A8806_1231, partial [Faecalicatena orotica] hypothetical protein SAMN05216536_1231, partial [Faecalicatena orotica] |
1.62e-24 | 82 | 46.018 | PWJ19412 |
uncharacterized protein BN671_01363 [Roseburia sp. CAG:471] |
1.92e-24 | 98 | 52.427 | CDD98389 |
hypothetical protein B5F07_21670 [Lachnoclostridium sp. An169] |
2.83e-24 | 100 | 48.515 | OUP79670 |
MULTISPECIES: Rpn family recombination-promoting nuclease/putative transposase [Clostridiales] Rpn family recombination-promoting nuclease/putative transposase [Lachnospiraceae bacterium OF09-33XD] |
2.96e-24 | 100 | 52.381 | WP_118646581 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] hypothetical protein C824_00813 [Schaedlerella arabinosiphila] |
7.98e-24 | 99 | 42.537 | WP_004069682 |
hypothetical protein [Lachnoclostridium sp. An169] |
1.25e-23 | 100 | 48.515 | WP_087163272 |
Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] Rpn family recombination-promoting nuclease/putative transposase [Schaedlerella arabinosiphila] |
1.6e-23 | 99 | 41.304 | WP_125126135 |
Rpn family recombination-promoting nuclease/putative transposase [Faecalicatena orotica] putative transposase/invertase (TIGR01784 family) [Faecalicatena orotica] conserved hypothetical protein (putative transposase or invertase) [Faecalicatena orotica] |
6.38e-23 | 100 | 71.429 | WP_109730858 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_93 In ecoli U00096.3
Seq (len = 54 ):
MLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGEAIIENM
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|44671|1|1211409-1211574
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
7.073386632649113
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_94 In blautia CP039126.1
Seq (len = 24 ):
LKKRNSSAKPLTRVCIFWKRWKQR
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|98235|1|2554577-2554649
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.5090120535914644
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 30 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
NADP-dependent isocitrate dehydrogenase [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
2.06e-31 | 100 | 100.000 | MQK28993 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
2.7e-31 | 100 | 100.000 | MQI91871 |
isocitrate dehydrogenase [Escherichia coli] |
4.12e-31 | 100 | 100.000 | STM58681 |
MULTISPECIES: isocitrate dehydrogenase [Gammaproteobacteria] isocitrate dehydrogenase [Escherichia coli str. K-12 substr. MG1655] isocitrate dehydrogenase [NADP] [Escherichia coli KTE40] isocitrate dehydrogenase [NADP] [Escherichia coli KTE64] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 3-105-05_S4_C1] isocitrate dehydrogenase [Escherichia coli BW25113] isocitrate dehydrogenase [Escherichia coli O16:H48] isocitrate dehydrogenase [Escherichia coli K-12] isocitrate dehydrogenase [Escherichia coli DH1] |
4.25e-31 | 100 | 100.000 | WP_000943927 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
4.47e-31 | 100 | 100.000 | MWR91088 |
isocitrate dehydrogenase [Shigella sonnei] isocitrate dehydrogenase [Escherichia coli] |
5.22e-31 | 100 | 100.000 | CSF35623 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
5.62e-31 | 100 | 100.000 | MWT25551 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
7.55e-31 | 100 | 100.000 | MWL01316 |
isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
8.94e-31 | 100 | 100.000 | STM19132 |
MULTISPECIES: isocitrate dehydrogenase [Bacteria] |
1.12e-30 | 100 | 98.148 | WP_072251074 |
isocitrate dehydrogenase [Escherichia coli] |
1.12e-30 | 100 | 98.148 | WP_077781419 |
isocitrate dehydrogenase [Citrobacter freundii] |
1.38e-30 | 100 | 96.296 | WP_087878723 |
isocitrate dehydrogenase [Escherichia coli] |
1.55e-30 | 100 | 98.148 | WP_097455283 |
hypothetical protein [Citrobacter sp. MGH109] isocitrate dehydrogenase [NADP] [Citrobacter sp. MGH109] |
1.57e-30 | 100 | 96.296 | WP_048241098 |
NADP-dependent isocitrate dehydrogenase [Salmonella enterica] |
2.01e-30 | 100 | 96.296 | EBA3555660 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
2.05e-30 | 100 | 96.296 | MQK28213 |
isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii ATCC 8090 = MTCC 1658] [Citrobacter freundii ATCC 8090 = MTCC 1658 = NBRC 12681] isocitrate dehydrogenase [Citrobacter freundii RLS1] isocitrate dehydrogenase [Citrobacter freundii ATCC 8090 = MTCC 1658] [Citrobacter freundii ATCC 8090 = MTCC 1658 = NBRC 12681] isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii ATCC 8090 = MTCC 1658 = NBRC 12681] |
2.26e-30 | 100 | 96.296 | WP_003840849 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
2.33e-30 | 100 | 96.296 | KAE9951161 |
isocitrate dehydrogenase [Escherichia coli] |
2.6e-30 | 100 | 96.296 | STF39596 |
NADP-dependent isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Kentucky] |
2.77e-30 | 100 | 96.296 | EBK2324911 |
isocitrate dehydrogenase [Citrobacter sp. BIDMC107] isocitrate dehydrogenase [NADP] [Citrobacter sp. BIDMC107] |
2.78e-30 | 100 | 96.296 | WP_075261943 |
isocitrate dehydrogenase [Salmonella enterica] isocitrate dehydrogenase [Salmonella enterica subsp. enterica] |
3.54e-30 | 100 | 96.296 | EBU6208613 |
Isocitrate dehydrogenase [Klebsiella pneumoniae] |
3.63e-30 | 100 | 96.296 | SWC29732 |
isocitrate dehydrogenase [Escherichia coli] |
3.65e-30 | 100 | 96.296 | WP_149008206 |
isocitrate dehydrogenase [Yokenella regensburgei] Isocitrate dehydrogenase [NADP] [Yokenella regensburgei] |
4e-30 | 100 | 96.296 | WP_120816459 |
MULTISPECIES: isocitrate dehydrogenase [Escherichia] isocitrate dehydrogenase, partial [Phage 21] isocitrate dehydrogenase [Salmonella enterica] conserved hypothetical protein [Escherichia coli B088] isocitrate dehydrogenase domain protein [Escherichia coli RN587/1] hypothetical protein SSJG_01407 [Escherichia coli D9] isocitrate dehydrogenase domain protein [Escherichia coli STEC_B2F1] icd domain protein [Escherichia coli DEC11A] icd domain protein [Escherichia coli DEC11B] dehydrogenase, isocitrate/isopropylmalate domain protein [Escherichia coli 96.0497] dehydrogenase, isocitrate/isopropylmalate domain protein [Escherichia coli 96.154] dehydrogenase, isocitrate/isopropylmalate domain protein [Escherichia coli 9.0111] dehydrogenase, isocitrate/isopropylmalate domain protein [Escherichia coli 4.0967] isocitrate dehydrogenase [Escherichia coli 07798] isocitrate dehydrogenase [NADP] [Escherichia coli KTE28] isocitrate dehydrogenase [NADP] [Escherichia coli KTE165] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 179100] isocitrate dehydrogenase [NADP] [Escherichia coli KOEGE 131 (358a)] isocitrate dehydrogenase [NADP] [Escherichia coli UMEA 3705-1] isocitrate dehydrogenase [NADP] [Escherichia coli KOEGE 7 (16a)] isocitrate dehydrogenase [NADP] [Escherichia coli HVH 108 (4-6924867)] isocitrate dehydrogenase [Enterobacteriaceae bacterium TzEc052] isocitrate dehydrogenase [NADP] [Escherichia coli UCI 66] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 3-267-03_S4_C2] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 2-210-07_S3_C2] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 3-073-06_S1_C1] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 3-475-03_S3_C1] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 5-366-08_S1_C1] isocitrate/isopropylmalate dehydrogenase family protein [Escherichia coli 5-366-08_S3_C2] isocitrate dehydrogenase [Shigella sonnei] isocitrate dehydrogenase [Escherichia coli O113:H21] |
4.04e-30 | 100 | 96.296 | WP_000943926 |
isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Reading] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Sandiego] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Chester] isocitrate dehydrogenase [Salmonella enterica] isocitrate dehydrogenase [Salmonella enterica subsp. enterica] |
4.22e-30 | 100 | 96.296 | EBX0712685 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
4.48e-30 | 100 | 96.296 | MWR89926 |
isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli APEC O2-211] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
4.55e-30 | 100 | 96.296 | WP_095501568 |
isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Chester] |
4.61e-30 | 100 | 96.296 | EDC3951707 |
isocitrate dehydrogenase [Salmonella enterica] isocitrate dehydrogenase [Salmonella enterica subsp. enterica] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Montevideo] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Eastbourne] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Chester] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Arechavaleta] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Sandiego] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Bukavu] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Reading] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Infantis] |
4.71e-30 | 100 | 96.296 | WP_079969881 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
4.73e-30 | 100 | 96.296 | TEW08712 |
isocitrate dehydrogenase [Escherichia coli] |
4.95e-30 | 100 | 96.296 | STI76415 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
4.97e-30 | 100 | 96.296 | MWT21376 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
4.99e-30 | 100 | 96.296 | MWL47497 |
isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Chester] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Chester] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Chester] |
5.09e-30 | 100 | 96.296 | EBV8406779 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
5.19e-30 | 100 | 96.296 | RLY38540 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
5.29e-30 | 100 | 96.296 | MPU52468 |
hypothetical protein Q610_ECBC00365G0001, partial [Escherichia coli DORA_B_14] |
5.29e-30 | 100 | 96.296 | ETI99341 |
isocitrate dehydrogenase [NADP] [Escherichia coli KTE128] |
5.72e-30 | 100 | 96.296 | ELI59750 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
5.77e-30 | 100 | 96.296 | TFO91866 |
isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] |
6.92e-30 | 100 | 94.444 | WP_114675585 |
MULTISPECIES: isocitrate dehydrogenase [Citrobacter freundii complex] isocitrate dehydrogenase [NADP] [Citrobacter sp. MGH110] |
7.4e-30 | 100 | 94.444 | WP_139239311 |
isocitrate dehydrogenase [Escherichia coli ECA-727] isocitrate dehydrogenase [Escherichia coli] |
7.49e-30 | 100 | 100.000 | EST77057 |
NADP-dependent isocitrate dehydrogenase, partial [Alistipes onderdonkii] |
7.72e-30 | 100 | 96.296 | KAA3080904 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
7.76e-30 | 100 | 96.296 | MWL01309 |
isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] |
7.81e-30 | 100 | 94.444 | WP_096879191 |
isocitrate dehydrogenase [Salmonella enterica] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Matadi] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Denver] isocitrate dehydrogenase [Salmonella enterica subsp. enterica serovar Denver] isocitrate dehydrogenase [Salmonella enterica subsp. enterica] |
8.16e-30 | 100 | 96.296 | EBT6590306 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
8.24e-30 | 100 | 96.296 | PSG67139 |
hypothetical protein, partial [Escherichia coli] |
8.46e-30 | 100 | 96.296 | WP_000541450 |
MULTISPECIES: hypothetical protein [Citrobacter freundii complex] isocitrate dehydrogenase [Citrobacter portucalensis] hypothetical protein AN688_0225700 [Citrobacter freundii] |
9.21e-30 | 100 | 94.444 | WP_057069895 |
hypothetical protein [Citrobacter freundii] hypothetical protein AN690_0225765 [Citrobacter freundii] |
9.41e-30 | 100 | 94.444 | WP_069683739 |
isocitrate dehydrogenase (NADP(+)) [Escherichia coli] isocitrate dehydrogenase [NADP] [Escherichia coli HVH 41 (4-2677849)] isocitrate dehydrogenase [NADP] [Escherichia coli UMEA 3033-1] isocitrate dehydrogenase domain protein [Escherichia coli LAU-EC10] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
9.42e-30 | 100 | 94.444 | WP_021519699 |
isocitrate dehydrogenase [NADP] [Escherichia coli TA271] isocitrate dehydrogenase [NADP] (Oxalosuccinatedecarboxylase) (IDH) (NADP(+)-specific ICDH) (IDP) [Escherichia coli TA255] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
9.71e-30 | 100 | 96.296 | EGI37018 |
isocitrate dehydrogenase, partial [Acinetobacter baumannii] |
9.8e-30 | 96 | 100.000 | WP_109267799 |
MULTISPECIES: isocitrate dehydrogenase (NADP(+)) [Enterobacteriaceae] isocitrate dehydrogenase [NADP] [Escherichia coli KTE135] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
1.01e-29 | 100 | 94.444 | WP_001597767 |
MULTISPECIES: isocitrate dehydrogenase [Enterobacteriaceae] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
1.03e-29 | 100 | 94.444 | WP_074388893 |
hypothetical protein [Escherichia coli] |
1.07e-29 | 100 | 96.296 | WP_063102795 |
hypothetical protein, partial [Escherichia coli] isocitrate dehydrogenase, partial [Escherichia coli CUMT8] |
1.08e-29 | 100 | 96.296 | WP_000295222 |
hypothetical protein [Citrobacter freundii] hypothetical protein TO64_05935 [Citrobacter freundii] |
1.12e-29 | 100 | 94.444 | WP_044712049 |
isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
1.2e-29 | 100 | 94.444 | WP_123007709 |
isocitrate dehydrogenase [Citrobacter braakii] isocitrate dehydrogenase [Citrobacter braakii] |
1.2e-29 | 100 | 94.444 | WP_104651355 |
isocitrate dehydrogenase, partial [Escherichia coli] |
1.24e-29 | 100 | 94.444 | OVG48279 |
isocitrate dehydrogenase [Citrobacter werkmanii] isocitrate dehydrogenase [Citrobacter werkmanii] |
1.24e-29 | 100 | 94.444 | WP_096757350 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase, partial [Shigella boydii] |
1.34e-29 | 100 | 100.000 | MXG85399 |
hypothetical protein [Citrobacter braakii] hypothetical protein IB70_15640 [Citrobacter braakii] |
1.49e-29 | 100 | 94.444 | WP_047500601 |
MULTISPECIES: isocitrate dehydrogenase [Citrobacter] isocitrate dehydrogenase [Citrobacter sp. A316] isocitrate dehydrogenase [Citrobacter braakii] isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter sp. wls712] |
1.56e-29 | 100 | 94.444 | WP_072276928 |
hypothetical protein BMI82_23415 [Escherichia coli] |
1.83e-29 | 98 | 98.113 | ARQ26502 |
hypothetical protein WM44_08940 [Citrobacter sp. AATXQ] isocitrate dehydrogenase [NADP] [Citrobacter freundii] |
1.9e-29 | 100 | 92.593 | KYC26940 |
isocitrate dehydrogenase, partial [Shigella sonnei] isocitrate dehydrogenase [NADP], partial [Escherichia coli HVH 85 (4-0792144)] isocitrate dehydrogenase, partial [Escherichia coli] |
2.01e-29 | 98 | 96.226 | WP_000696270 |
isocitrate dehydrogenase [Escherichia coli] |
2.05e-29 | 100 | 94.444 | WP_072128656 |
isocitrate dehydrogenase [Escherichia albertii] |
2.08e-29 | 100 | 94.444 | WP_072248479 |
isocitrate dehydrogenase [Escherichia coli] |
2.09e-29 | 100 | 94.444 | WP_139058216 |
isocitrate dehydrogenase [Escherichia coli] |
2.18e-29 | 100 | 100.000 | STM44929 |
isocitrate dehydrogenase [Escherichia coli] |
2.19e-29 | 100 | 94.444 | WP_157276153 |
isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [NADP] [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] |
2.34e-29 | 100 | 92.593 | WP_086504263 |
isocitrate/isopropylmalate dehydrogenase family protein, partial [Escherichia coli 95.0083] |
2.6e-29 | 100 | 96.296 | ELW42395 |
isocitrate dehydrogenase [Escherichia coli] Isocitrate dehydrogenase [NADP] [Escherichia coli] Isocitrate dehydrogenase [NADP] [Escherichia coli] |
2.96e-29 | 100 | 92.593 | WP_124056032 |
MULTISPECIES: isocitrate dehydrogenase [Citrobacter freundii complex] |
3.26e-29 | 100 | 92.593 | WP_140158709 |
MULTISPECIES: isocitrate dehydrogenase [Citrobacter freundii complex] isocitrate dehydrogenase [Citrobacter freundii complex sp. CFNIH9] |
3.56e-29 | 100 | 92.593 | WP_103285069 |
MULTISPECIES: isocitrate dehydrogenase [Citrobacter freundii complex] isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] |
3.71e-29 | 100 | 92.593 | WP_072324104 |
isocitrate dehydrogenase [Citrobacter freundii] |
4.19e-29 | 100 | 92.593 | WP_109908315 |
isocitrate dehydrogenase [Escherichia coli KD1] |
4.88e-29 | 98 | 94.340 | EIL54835 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
4.91e-29 | 100 | 100.000 | RLY65794 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
5.54e-29 | 100 | 100.000 | WP_113446024 |
isocitrate dehydrogenase [Shigella sonnei] |
5.58e-29 | 100 | 100.000 | CSO60613 |
NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
6.34e-29 | 100 | 100.000 | WP_140044748 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] NADP-dependent isocitrate dehydrogenase, partial [Escherichia coli] |
6.68e-29 | 100 | 100.000 | MXH06348 |
isocitrate dehydrogenase [Escherichia coli] |
6.9e-29 | 100 | 96.296 | GCW17282 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
7e-29 | 100 | 100.000 | MWR40574 |
isocitrate dehydrogenase (NADP(+)), partial [Escherichia coli] |
7.3e-29 | 100 | 96.296 | ONG34690 |
NADP-dependent isocitrate dehydrogenase [Escherichia coli] |
7.81e-29 | 100 | 96.296 | HAT97295 |
isocitrate dehydrogenase [Escherichia coli ECC-1470] |
8.81e-29 | 100 | 96.296 | EST85148 |
hypothetical protein, partial [Escherichia coli] isocitrate dehydrogenase domain protein, partial [Escherichia coli E128010] |
8.83e-29 | 100 | 96.296 | WP_000740321 |
isocitrate dehydrogenase [Citrobacter freundii ATCC 8090 = MTCC 1658] [Citrobacter freundii ATCC 8090 = MTCC 1658 = NBRC 12681] |
8.86e-29 | 100 | 90.741 | EKS55205 |
isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] |
8.94e-29 | 100 | 90.741 | WP_106107290 |
MULTISPECIES: isocitrate dehydrogenase [Citrobacter] isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii] isocitrate/isopropylmalate dehydrogenase family protein [Citrobacter freundii] isocitrate dehydrogenase [NADP] [Citrobacter sp. MGH109] isocitrate dehydrogenase [Citrobacter freundii] |
8.94e-29 | 100 | 90.741 | WP_075206724 |
isocitrate dehydrogenase [Citrobacter freundii] isocitrate dehydrogenase [Citrobacter freundii ATCC 8090 = MTCC 1658 = NBRC 12681] isocitrate dehydrogenase [Citrobacter freundii] |
9.66e-29 | 100 | 90.741 | WP_100225774 |
isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
1.09e-28 | 100 | 94.444 | WP_127528378 |
isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] isocitrate dehydrogenase [Escherichia coli] |
1.14e-28 | 100 | 94.444 | OWG40642 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_95 In blautia CP039126.1
Seq (len = 35 ):
MWKPIPHQAFTRIMVVMAVFLSTSQLFTRLSRPIP
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|164606|1|4512624-4512738
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.210184343560489
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_96 In bact CP040530.1
Seq (len = 39 ):
IYHSRGGFYPAQSRFDPSGGIAGRAQTDRSGRIFRRFYL
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|306160|-1|5276634-5276838
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7189666327522723
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 22 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_97 In ery NZ_CP036346.1
Seq (len = 29 ):
LSNNRDTDFINLFNKIIFTYLNLQTRNRL
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|145645|1|2129018-2129114
Transkriptom
39.0% of gene length expressed over median expression of contig.
ŝ
2.1372724716820253
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_98 In ecoli U00096.3
Seq (len = 37 ):
MHYRNVIAVLVCSAGLIHQHSLNYSLLNREIRKHSKT
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|219319|-1|3247616-3247730
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.4373107005713122
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_99 In clostri CP040626.1
Seq (len = 34 ):
INTSFHYHLTIQFSLIHRCLNNTIYLHLDTILLP
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|503148|-1|393105-393207
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.9729223361802175
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_100 In clostri CP040626.1
Seq (len = 23 ):
IFTFKYFCKLITIRIFFKIILSI
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|256419|1|3832583-3832676
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.9894173915559359
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_101 In blautia CP039126.1
Seq (len = 45 ):
PKNGPAGFLPLQGVSVGKRLTWKIDIMVALSVLIAEDGTLLAVMR
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|337305|-1|3270357-3270492
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.404136510091732
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_102 In blautia CP039126.1
Seq (len = 99 ):
MKFFSGKSREEFESVAKANEYLNEAYHTLRTMSADEKKRMEYEARDKALRDYNSQISSAERRGEERTRQVFKLYIQGETQENIAKICGMTLEKVKEILQ
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|227848|-1|6103795-6104173
Transkriptom
99.0% of gene length expressed over median expression of contig.
ŝ
3.8762572184098225
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_103 In blautia CP039126.1
Seq (len = 16 ):
MLYSPFWAAAISPAAP
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|118042|1|3098856-3099303
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.87942606879415
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 13 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_104 In blautia CP039126.1
Seq (len = 93 ):
LLSQFPDIIGNDTVLRIHIGFLCKGIETSIDKQLRRQGKPSGLLFRLEHELTVQILQGRHFALVTASYIFPVHICGTAVQNGFFLCRQVTSPH
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|113759|1|2967043-2967511
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8268137315877258
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_105 In bifi AE014295.3
Seq (len = 43 ):
ISSGGDIYLAFEGLLKRQTASINGFAATPLRHCGALSTRASAP
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|89100|-1|542952-543198
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.5497508916806388
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_106 In bact CP040530.1
Seq (len = 22 ):
STRRKSCEYLYRRINKVINKIL
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|510464|-1|361329-361395
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.195860567664649
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_107 In anaero CP036345.1
Seq (len = 86 ):
MDLRHDLQYQILRKCRHLRPVLDVRPELYFHGRICHTFAVKDTVFVDRLVKEILRHAEVCINVCRRSQVTFVCRSGCDRSCIHQCN
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|220269|-1|1496349-1496640
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.2165728820826827
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 33 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_108 In ery NZ_CP036346.1
Seq (len = 54 ):
MIVNTYTNSCNLLSNFYYFIGQFMKRYFINTKQEVLQYIILRLSKKLNIKNCDY
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|170734|1|2520091-2520256
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.445308983389292
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_109 In ecoli U00096.3
Seq (len = 56 ):
MPVSLTASSAKSLACFSPASRMAAMANWRIATLFNPCWATLAAATASSRDAKTPIS
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|95220|1|2571464-2571668
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9965394678904933
unique PSMS
3
unique PSMS
3
Genomic Context
Candidate has annotation on OTHER strand. Which has 8 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_110 In ecoli U00096.3
Seq (len = 34 ):
PGRKRYASCKGWGTAKVMVTASRVSDSTFATVKE
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|286705|-1|1456443-1456545
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.70172928302305
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_111 In blautia CP039126.1
Seq (len = 28 ):
MTAITLPYPRLKFWNAFTNRCIGRTSVE
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|446173|-1|58655-58805
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9510405629176322
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_112 In blautia CP039126.1
Seq (len = 22 ):
DPGENGMLQTMWNTTQKKNHFR
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|327071|-1|3532919-3532985
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9567687506363443
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_113 In blautia CP039126.1
Seq (len = 60 ):
LNDRYCSDQDHTPDNQRRAIPLIVLHKRLLVEIIKDRLRTADRRVRLLDHHIDNVKHFQG
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|139940|1|3755739-3756078
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.5049184163405975
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_114 In bact CP040530.1
Seq (len = 41 ):
ICSSVFSGWEKGHFCKCYGNNRGFTFLDSERRTIAMLETTL
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|513824|-1|286527-286665
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.1414628024303606
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_115 In bact CP040530.1
Seq (len = 55 ):
MAITIKNIPVLEGVTAEDFVRSADKNAAKVTPRLSVEAKKRLRKVLEKSRSFRFN
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|318427|-1|4999584-4999782
Transkriptom
53.0% of gene length expressed over median expression of contig.
ŝ
4.507193065291546
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_116 In anaero CP036345.1
Seq (len = 51 ):
MRIDLSPGIGHILSGICVLPVQPADRFLRLAKRLVKPGLDEGKVLPFIREL
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|167380|-1|2861377-2861554
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.973194450526152
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_117 In anaero CP036345.1
Seq (len = 58 ):
MPYIPSWNVLLTTSSCCSLESLLKFTAYPETRIVSVGYLSGCSIASINVSRLNTLTFR
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|12465|1|303162-303450
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.2941362877160807
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 6 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_118 In lacto CP039121.1
Seq (len = 47 ):
MPKPPPIHIKGIPPVKAQPHIMVTTFLIILGSVYALLPGTTNRSALF
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|50215|1|906273-906447
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.086362725980945
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_119 In lacto CP039121.1
Seq (len = 21 ):
LNSVIKDVINHRSIRCVFLNT
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|282707|-1|1090572-1090659
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.614989875406625
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein PARMER_01731 [Parabacteroides merdae ATCC 43184] hypothetical protein BACDOR_04053 [Bacteroides dorei DSM 17855] hypothetical protein BSIG_1900 [Bacteroides thetaiotaomicron] hypothetical protein HMPREF1016_03614 [Bacteroides eggerthii 1_2_48FAA] hypothetical protein HMPREF1072_02688 [Bacteroides uniformis CL03T00C23] hypothetical protein HMPREF1073_02447 [Bacteroides uniformis CL03T12C37] hypothetical protein HMPREF1078_01739 [Parabacteroides merdae CL09T00C40] hypothetical protein HMPREF9447_01118 [Bacteroides oleiciplenus YIT 12058] hypothetical protein HMPREF1534_03644 [Bacteroides massiliensis B84634 = Timone 84634 = DSM 17679 = JCM 13223] hypothetical protein C800_01526 [Bacteroides vulgatus dnLKV7] hypothetical protein M099_3733 [Bacteroides vulgatus str. 3975 RP4] hypothetical protein M095_2511 [Parabacteroides distasonis str. 3999B T(B) 4] hypothetical protein M096_1583 [Parabacteroides distasonis str. 3999B T(B) 6] hypothetical protein HMPREF1002_00209 [Porphyromonas sp. 31_2] hypothetical protein VIC01_00856 [Bacteroides vulgatus] uncharacterized protein BN727_00497 [Bacteroides sp. CAG:598] Uncharacterised protein [Parabacteroides merdae] |
5.1e-30 | 100 | 100.000 | EDN86370 |
hypothetical protein HMPREF0999_02081 [Parabacteroides sp. D25] hypothetical protein BSDG_02037 [Parabacteroides sp. 2_1_7] |
1.91e-29 | 100 | 98.182 | EKN29943 |
hypothetical protein HMPREF1065_01341 [Bacteroides dorei CL03T12C01] hypothetical protein M093_3539 [Bacteroides uniformis str. 3978 T3 i] hypothetical protein M093_2696 [Bacteroides uniformis str. 3978 T3 i] |
2.15e-29 | 100 | 98.182 | EIY40053 |
hypothetical protein HMPREF1181_02719 [Bacteroides stercoris CC31F] |
2.48e-29 | 100 | 98.182 | EPH18617 |
hypothetical protein Bacsa_0481 [Bacteroides salanitronis DSM 18170] |
4.65e-26 | 100 | 89.091 | ADY35079 |
hypothetical protein HMPREF1070_02110 [Bacteroides ovatus CL03T12C18] |
4.38e-25 | 100 | 89.091 | EIY66510 |
hypothetical protein BACEGG_01113 [Bacteroides eggerthii DSM 20697] hypothetical protein HMPREF2141_02518 [Bacteroides uniformis] |
8.32e-25 | 100 | 85.455 | EEC54589 |
hypothetical protein HMPREF1062_06275 [Bacteroides cellulosilyticus CL02T12C19] hypothetical protein HMPREF1063_03890 [Bacteroides dorei CL02T00C15] hypothetical protein HMPREF1064_03529 [Bacteroides dorei CL02T12C06] hypothetical protein HMPREF1071_01048 [Bacteroides salyersiae CL02T12C01] hypothetical protein M125_1371 [Bacteroides fragilis str. 3998T(B)3] hypothetical protein M081_1087 [Bacteroides fragilis str. 3998 T(B) 4] hypothetical protein M107_5165 [Bacteroides fragilis str. 3725 D9(v)] hypothetical protein M123_4757 [Bacteroides fragilis str. 3976T8] hypothetical protein M089_5928 [Bacteroides ovatus str. 3725 D9 iii] hypothetical protein M082_2196 [Bacteroides fragilis str. 3725 D9 ii] hypothetical protein HMPREF9009_02405 [Bacteroides sp. 3_1_13] hypothetical protein CQW34_01259 [Bacteroides fragilis] Uncharacterised protein [Bacteroides vulgatus] Uncharacterised protein [Bacteroides uniformis] Uncharacterised protein [Parabacteroides distasonis] Uncharacterised protein [Bacteroides eggerthii] |
9.45e-25 | 100 | 85.455 | EIY16616 |
putative uncharacterized protein [Prevotella sp. CAG:1058] |
4.06e-22 | 98 | 81.481 | CCX66934 |
putative uncharacterized protein [Bacteroides sp. CAG:754] |
6.49e-17 | 98 | 66.667 | CDA82908 |
hypothetical protein BvMPK_2235 [Bacteroides vulgatus] |
1.16e-13 | 84 | 71.739 | ALK84835 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_120 In lacto CP039121.1
Seq (len = 15 ):
MIYSSASQNFSDKLI
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|12459|1|219153-219279
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.0218194830625857
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_121 In ery NZ_CP036346.1
Seq (len = 25 ):
VISWDNTGDKNCDNCANNSYQDTFK
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|265590|-1|2536449-2536638
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8526328922062132
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
putative transporter [Escherichia coli] |
9.6e-09 | 98 | 57.895 | STK22537 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_122 In ecoli U00096.3
Seq (len = 101 ):
LRSSATRRASFRGVAIWSSNGAVMKLVTGVLFCTLPMEDGCMNPGRWRLPGEYMRYGALTRRWSPVMTALLHVFLTPMVNCPMPRFFCLNQKSCCKLSARR
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|64730|1|1731091-1731394
Transkriptom
7.000000000000001% of gene length expressed over median expression of contig.
ŝ
2.3439017979871677
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_123 In ecoli U00096.3
Seq (len = 43 ):
MAHACIKKDVSLIKNKKYFTRQEYLYCARYVGFDCKSERRKHL
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|60925|1|1629038-1629215
Transkriptom
31.0% of gene length expressed over median expression of contig.
ŝ
2.1093927086326856
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 11 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_124 In ecoli U00096.3
Seq (len = 17 ):
ITKVSDMFRITGSYPKR
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|219272|-1|3248809-3248962
Transkriptom
79.0% of gene length expressed over median expression of contig.
ŝ
1.9962523310324942
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_125 In ecoli U00096.3
Seq (len = 29 ):
MAAVFAQAAIKHHYRLTVRVNDVIDLIHA
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|104432|1|2838535-2838880
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7266128598683161
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{translation on same strand (frameshift candidate)}
Candidate nov_psm6_126 In blautia CP039126.1
Seq (len = 578 ):
MEKINKEQLLVKKKGLEKELEKLKNANIIPDSQKSEAGGEGSGGNIVGAGTKSGILPLGLKETNTGTGGRWEASFSKMAASQNAGRTADSGEQGNPGNLDDPGNTDNPDNPGTPDDPENPGTPDNPGNPEEPENPEEPENPGNPEEPENPGTPDNPDNPDNPGNPEEPGNPDDPQKPSKPVPSMVYDKLYGDITLETIPGQKIENAIPYKGTGTKEDPYYYLCKKDVKIQGAFLNQIAGYGTSDTKEKEPVYCILEVRDKDDKDGFLIAALCLDGSKITQLAAPEKWYLTHLGTYTEEEPQIPDEENPDGDDGEEFPDDWDFMEEIPQDDIIEGYTQDELNKAITEKKKEIKTAELDIRGSSLKIQNVEKKLENQTVESILNGVVKKVGDPGKVEVDGEAFLVVESSEGSYVKGLADEYQLQQLQPGSVLTGFSYESGLPIEAEVKEISNFPSSNNMYGYGREVSYYPFTAYIKNSDGLKNMEGVSLDLPSETENPAGLYISKEYVRNKDGKDFVYVEGKDHRLERRNVQVGKNFYGSMLEIKNGLTEEDHIAFPYGKKVKEGVKVRRAAIEDLYSMY
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|325700|-1|3569827-3571903
Transkriptom
83.0% of gene length expressed over median expression of contig.
ŝ
5.66031143438672
unique PSMS
6
unique PSMS
6
Genomic Context
Candidate has annotation on SAME strand. Which has 9 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
member of ATP-dependent helicase superfamily II [Escherichia coli H617]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
putative ATP-dependent helicase lhr [Shigella flexneri CDC 796-83] |
1.5e-55 | 100 | 89.109 | EFW61063 |
putative ATP-dependent helicase Lhr [Shigella sonnei] |
1.38e-49 | 87 | 92.045 | CSE81663 |
member of ATP-dependent helicase superfamily II [Escherichia coli H617] |
1.02e-38 | 74 | 85.333 | OSL30695 |
ATP-dependent helicase [Escherichia coli] |
8.13e-29 | 59 | 90.000 | GCI89796 |
ATP-dependent helicase [Escherichia coli] |
1.54e-28 | 52 | 96.226 | SPW57589 |
ATP-dependent helicase [Escherichia coli] |
3.04e-17 | 55 | 67.857 | STJ86065 |
ATP-dependent helicase [Escherichia coli] |
6.95e-17 | 55 | 67.857 | STK05192 |
DEAD/DEAH box helicase family protein [Shigella flexneri CCH060] |
1.52e-16 | 44 | 88.636 | EIQ12125 |
unnamed protein product DEAD/DEAH box helicase [Shigella boydii] DEAD/DEAH box helicase [Shigella flexneri] DEAD/DEAH box helicase [Shigella flexneri] DEAD/DEAH box helicase [Shigella flexneri] DEAD/DEAH box helicase [Shigella flexneri] |
1.58e-16 | 44 | 88.636 | WP_073952980 |
ATP-dependent helicase [Escherichia coli] |
1.1e-10 | 40 | 75.000 | STK89303 |
ATP-dependent helicase [Escherichia coli] |
1.85e-08 | 34 | 76.471 | STI75732 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_127 In blautia CP039126.1
Seq (len = 81 ):
MHDPSRNLQTAFTACHTVKITYQAGNWKNWWNNLERDSVRHARQTTSAGSSIPYSHTRESTAFSVLWRKGTRRNSGWPRRS
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|290937|-1|4486548-4486851
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.1224367007649336
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
GntR family transcriptional regulator, partial [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein HMPREF9532_03398 [Escherichia coli MS 57-2] hypothetical protein HMPREF1604_01304 [Escherichia coli 908519] |
1.99e-23 | 100 | 100.000 | EGB76123 |
GntR family transcriptional regulator, partial [Escherichia coli] |
5.03e-23 | 100 | 100.000 | RAM07515 |
GntR family transcriptional regulator [Shigella boydii] |
7.11e-23 | 98 | 100.000 | EAA1152619 |
Transcriptional regulator, GntR family [Shigella flexneri CDC 796-83] hypothetical protein SFCCH060_1773 [Shigella flexneri CCH060] |
1.21e-22 | 98 | 100.000 | EFW58697 |
GntR family transcriptional regulator [Escherichia coli] |
1.25e-22 | 100 | 97.674 | EAA2361816 |
GntR family transcriptional regulator, partial [Shigella flexneri] |
1.77e-22 | 98 | 100.000 | PQO11103 |
GntR family transcriptional regulator, partial [Shigella sonnei] |
3.76e-22 | 100 | 97.674 | RIH02980 |
hypothetical protein ECMP02101711_1711 [Escherichia coli MP021017.11] |
2.6e-21 | 100 | 100.000 | EMV12316 |
MULTISPECIES: GntR family transcriptional regulator [Enterobacteriaceae] conserved hypothetical protein [Shigella boydii Sb227] hypothetical protein SB444474_1511 [Shigella boydii 4444-74] GntR family transcriptional regulator [Shigella boydii] GntR family transcriptional regulator [Shigella boydii] GntR family transcriptional regulator [Shigella boydii] |
1.39e-20 | 98 | 100.000 | WP_005005969 |
GntR family transcriptional regulator [Shigella boydii] |
1.43e-20 | 98 | 100.000 | MIZ45305 |
GntR family transcriptional regulator [Escherichia coli] |
2.88e-20 | 93 | 100.000 | EAA0946085 |
GntR family transcriptional regulator, partial [Bacillus sp. P16(2019)] |
1.59e-19 | 91 | 100.000 | TSB44404 |
GntR family transcriptional regulator [Escherichia coli] |
7.58e-18 | 86 | 100.000 | MGR72007 |
GntR family transcriptional regulator, partial [Escherichia coli] |
2.52e-14 | 74 | 100.000 | ONG20308 |
conserved hypothetical protein [Escherichia fergusonii ATCC 35469] |
1.46e-09 | 91 | 71.795 | CAQ89053 |
hypothetical protein ECD227_1421 [Escherichia fergusonii ECD227] |
1.75e-09 | 91 | 71.795 | EGC95183 |
GntR family transcriptional regulator, partial [Escherichia coli] |
5.62e-06 | 49 | 100.000 | TNS63239 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_128 In blautia CP039126.1
Seq (len = 32 ):
LQFSCLSEALLRYCGEGGRTLRTASLYCGVAD
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|12095|1|309461-309557
Transkriptom
98.0% of gene length expressed over median expression of contig.
ŝ
1.9413209638947646
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 13 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_129 In bifi AE014295.3
Seq (len = 61 ):
ACRKRTAARFRSTSRSASCRPAPRATRCGMPKTTNTRTLSSWTRWLTSTIRFVRLTLLACT
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|71227|-1|1336195-1336378
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.3083292344054804
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Cna B-type domain-containing protein [Robinsoniella sp. KNHs210]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Blautia producta] hypothetical protein PMF13cell1_03381 [Blautia producta] |
0.0 | 100 | 90.119 | WP_130181453 |
hypothetical protein EV205_11414 [Blautia coccoides] endo-beta-N-acetylglucosaminidase [Blautia coccoides] |
0.0 | 100 | 93.632 | TCO59034 |
hypothetical protein [Blautia marasmi] |
0.0 | 100 | 78.388 | WP_104805103 |
MULTISPECIES: hypothetical protein [Blautia] hypothetical protein A4V09_09740 [Blautia sp. YL58] hypothetical protein ADH70_008185 [Blautia coccoides] |
0.0 | 70 | 87.841 | WP_065542197 |
hypothetical protein [Blautia hominis] |
0.0 | 70 | 88.861 | WP_156087478 |
hypothetical protein DW128_03765 [Firmicutes bacterium AM10-47] hypothetical protein DXB47_03740 [Firmicutes bacterium OM04-13BH] |
1.19e-151 | 99 | 45.425 | RGF22511 |
putative uncharacterized protein [Firmicutes bacterium CAG:227] |
4.55e-144 | 77 | 51.667 | CDC94128 |
hypothetical protein [Blautia sp. Marseille-P3201T] |
5.92e-134 | 67 | 53.807 | WP_072449629 |
MULTISPECIES: hypothetical protein [unclassified Blautia] hypothetical protein B5G33_20375 [Blautia sp. An81] hypothetical protein B5G00_12240 [Blautia sp. An46] |
2.39e-133 | 76 | 47.427 | WP_087273091 |
biotin/lipoyl-binding protein [Firmicutes bacterium] putative uncharacterized protein [Firmicutes bacterium CAG:424] |
1.57e-131 | 100 | 42.808 | WP_022268424 |
hypothetical protein [Lachnospiraceae bacterium 6_1_63FAA] hypothetical protein HMPREF0992_01096 [Lachnospiraceae bacterium 6_1_63FAA] |
1.14e-123 | 72 | 51.551 | WP_009246759 |
hypothetical protein [Blautia hansenii] hypothetical protein CGC63_05250 [Blautia hansenii DSM 20583] hypothetical protein BLAHAN_06732 [Blautia hansenii DSM 20583] putative uncharacterized protein [Lachnospiraceae bacterium CAG:364] |
1.29e-121 | 69 | 52.736 | WP_004222962 |
MULTISPECIES: hypothetical protein [unclassified Lachnospiraceae] hypothetical protein DW675_01095 [Lachnospiraceae bacterium AM25-22] hypothetical protein DW664_01100 [Lachnospiraceae bacterium AM25-11LB] hypothetical protein DW685_01100 [Lachnospiraceae bacterium AM25-40] hypothetical protein DW684_01215 [Lachnospiraceae bacterium AM25-39] |
7.29e-116 | 69 | 53.731 | WP_117466870 |
hypothetical protein [Lactonifactor longoviformis] hypothetical protein C3B58_09730 [Lactonifactor longoviformis] hypothetical protein SAMN02745158_00013 [Lactonifactor longoviformis DSM 17459] |
1.57e-113 | 99 | 41.522 | WP_072848074 |
MULTISPECIES: hypothetical protein [unclassified Lactonifactor] hypothetical protein [Lactonifactor sp. BIOML-A5] hypothetical protein [Lactonifactor sp. BIOML-A4] hypothetical protein [Lactonifactor sp. BIOML-A3] hypothetical protein [Lactonifactor sp. BIOML-A2] hypothetical protein [Lactonifactor sp. BIOML-A1] |
1.55e-105 | 99 | 40.657 | WP_154259479 |
Cna B-type domain-containing protein [Robinsoniella sp. KNHs210] |
1.01e-75 | 63 | 40.431 | WP_027293600 |
hypothetical protein RHS_3386 [Robinsoniella sp. RHS] |
1.02e-75 | 63 | 40.431 | KLU70836 |
Cna B-type domain-containing protein [Robinsoniella peoriensis] |
1.12e-75 | 63 | 40.431 | WP_070042520 |
Cna B-type domain-containing protein [Robinsoniella peoriensis] efflux transporter, RND family, MFP subunit [Robinsoniella peoriensis] |
1.55e-75 | 63 | 40.431 | WP_044293065 |
biotin/lipoyl-binding protein [Lachnospiraceae bacterium] biotin/lipoyl-binding protein [Lachnospiraceae bacterium] |
1.51e-74 | 62 | 40.369 | WP_135976501 |
biotin/lipoyl-binding protein [Anaerotruncus sp. 1XD22-93] biotin/lipoyl-binding protein [Anaerotruncus sp. 1XD22-93] |
2.79e-74 | 62 | 40.369 | WP_120483538 |
hypothetical protein [Lachnospiraceae bacterium] |
1.96e-71 | 62 | 40.483 | HCS84798 |
biotin/lipoyl-binding protein [Blautia sp. OF03-15BH] biotin/lipoyl-binding protein [Blautia sp. OF03-15BH] |
4.75e-69 | 65 | 38.422 | WP_117763944 |
biotin/lipoyl-binding protein [Blautia sp. OF03-15BH] biotin/lipoyl-binding protein [Blautia sp. OF03-15BH] |
4.89e-06 | 65 | 36.458 | WP_117763944 |
efflux RND transporter periplasmic adaptor subunit [Roseburia sp. 499] hypothetical protein BIV20_09565 [Roseburia sp. 499] |
5.16e-69 | 72 | 36.792 | WP_075720793 |
Ribonucleases G and E [uncultured Clostridium sp.] |
2.94e-68 | 65 | 38.168 | SCG87190 |
Ribonucleases G and E [uncultured Clostridium sp.] |
4.02e-06 | 65 | 36.458 | SCG87190 |
UNVERIFIED_CONTAM: hypothetical protein C7383_109158 [Murimonas intestini] |
1.49e-67 | 63 | 38.522 | PWJ74422 |
hypothetical protein [Murimonas intestini] |
1.95e-67 | 63 | 38.522 | WP_148409924 |
multidrug efflux system subunit MdtA [uncultured Ruminococcus sp.] |
5.79e-66 | 98 | 32.990 | SCH77566 |
putative ABC transporter [Firmicutes bacterium CAG:56] hypothetical protein [Lachnospiraceae bacterium] |
7.56e-65 | 98 | 32.818 | CDA64864 |
multidrug efflux system subunit MdtA [uncultured Ruminococcus sp.] |
8.3e-65 | 62 | 40.533 | SCJ74498 |
putative uncharacterized protein [Roseburia sp. CAG:45] |
1.5e-61 | 63 | 36.216 | CDC10705 |
HlyD family efflux transporter periplasmic adaptor subunit [Ruminococcaceae bacterium] |
1.53e-61 | 62 | 40.000 | WP_147631211 |
HlyD family efflux transporter periplasmic adaptor subunit [Lachnospiraceae bacterium A2] |
2.06e-61 | 65 | 39.695 | WP_084706269 |
MULTISPECIES: efflux RND transporter periplasmic adaptor subunit [unclassified Roseburia] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. OM04-10BH] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. OM04-15AA] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. OM04-10AA] |
2.13e-61 | 63 | 36.216 | WP_117946521 |
membrane-fusion protein [Roseburia sp.] |
2.2e-61 | 63 | 36.216 | HBM00946 |
efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF34-16] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF34-16] |
2.2e-61 | 63 | 36.216 | WP_118177129 |
efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF02-12] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF02-12] |
2.62e-61 | 63 | 36.216 | WP_118088270 |
efflux transporter%2C RND family%2C MFP subunit [uncultured Roseburia sp.] |
2.65e-61 | 63 | 36.216 | SCH11483 |
efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF12-17LB] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF12-17LB] |
4.59e-61 | 63 | 36.216 | WP_118664938 |
membrane-fusion protein [Roseburia sp.] |
4.68e-61 | 63 | 36.216 | HAX11722 |
MULTISPECIES: efflux RND transporter periplasmic adaptor subunit [unclassified Roseburia] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF42-8] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF20-18LB] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. OM03-7AC] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. OM03-18] |
1.4e-60 | 63 | 36.585 | WP_117697560 |
efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF15-21] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF15-21] |
1.42e-60 | 63 | 36.585 | WP_118639129 |
MULTISPECIES: efflux RND transporter periplasmic adaptor subunit [unclassified Roseburia] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF22-8AC] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF22-2LB] |
1.48e-60 | 63 | 36.314 | WP_118056417 |
MULTISPECIES: efflux RND transporter periplasmic adaptor subunit [unclassified Roseburia] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF25-25LB] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF25-18LB] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF25-15LB] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AF25-13LB] |
2.48e-60 | 63 | 36.585 | WP_118541334 |
hypothetical protein C810_04166 [Lachnospiraceae bacterium A2] |
2.69e-59 | 65 | 39.695 | EOS42839 |
putative uncharacterized protein [Roseburia sp. CAG:50] |
2.34e-58 | 73 | 34.272 | CCZ64157 |
Membrane-fusion protein [Roseburia intestinalis M50/1] |
7.64e-57 | 61 | 35.584 | CBL10369 |
biotin/lipoyl-binding protein [Roseburia sp. OF03-24] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. OF03-24] |
9e-57 | 61 | 35.325 | WP_117921537 |
efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AM23-20] efflux RND transporter periplasmic adaptor subunit [Roseburia sp. AM23-20] |
1.07e-56 | 61 | 35.325 | WP_118210061 |
HlyD family secretion protein [Coprococcus comes] HlyD family secretion protein [Coprococcus comes] |
1.43e-56 | 73 | 35.514 | WP_117824727 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein LG34_06715 [Eubacterium ramulus] hypothetical protein DXB15_09495 [Roseburia sp. OM02-15] |
1.65e-56 | 69 | 35.556 | WP_109215355 |
efflux RND transporter periplasmic adaptor subunit [Roseburia intestinalis] efflux RND transporter periplasmic adaptor subunit [Roseburia intestinalis] efflux RND transporter periplasmic adaptor subunit [Roseburia intestinalis] efflux RND transporter periplasmic adaptor subunit [Roseburia intestinalis] |
1.82e-56 | 61 | 35.325 | WP_118412407 |
hypothetical protein [Roseburia sp. 831b] hypothetical protein BIV16_06170 [Roseburia sp. 831b] |
2.25e-56 | 61 | 35.754 | WP_075679645 |
efflux RND transporter periplasmic adaptor subunit [Roseburia intestinalis] hypothetical protein ROSINTL182_05545 [Roseburia intestinalis L1-82] putative uncharacterized protein [Roseburia intestinalis CAG:13] efflux RND transporter periplasmic adaptor subunit [Roseburia intestinalis] membrane-fusion protein [Roseburia intestinalis] efflux RND transporter periplasmic adaptor subunit [Roseburia intestinalis] |
3.01e-56 | 61 | 35.325 | WP_006855683 |
HlyD family secretion protein [Coprococcus comes] HlyD family secretion protein [Coprococcus comes] |
1.3e-55 | 73 | 35.280 | WP_118217916 |
biotin/lipoyl-binding protein [Eubacterium ramulus] efflux transporter%2C RND family%2C MFP subunit [Eubacterium ramulus] |
1.41e-55 | 73 | 34.507 | WP_055290589 |
hypothetical protein [Clostridium sp. CL-6] |
1.6e-55 | 67 | 36.020 | WP_040192187 |
HlyD family secretion protein [Coprococcus comes] HlyD family secretion protein [Coprococcus comes] |
2.01e-55 | 73 | 35.280 | WP_117558277 |
putative uncharacterized protein [Firmicutes bacterium CAG:646] |
3.89e-55 | 57 | 47.934 | CCZ36227 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_130 In bifi AE014295.3
Seq (len = 325 ):
ILGGEDAGAAAGADESAQGVERIGHGEGEDGHDDQRQLGRIREQCREALGGEDRAEGLRQLGEGLADGLRVGPGGHAERDADYGGDGDGQQHAALNLHHGEHNGQYEADQEDPQHLVVKVGQTRGSRNGTALGGGLRIAGSELDQADVQHAHVGHEQADAAADGVLQGLRDGQDDHLADLGDGDEDVDQAAQEHHAHGLLPAEAEAEAHGVGEERVEAHAGGLGVRHVGEQAHDQGADDGRDDGGQEHAAPRHTRLRQDLRVDDDDVSHREERGQAGQNLSRDGRAVFLQMEELLHLLSTSLGLCGAAHRVHNAAAGPGENCDSP
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|43420|1|1955124-1956630
Transkriptom
90.0% of gene length expressed over median expression of contig.
ŝ
1.959134051694584
unique PSMS
3
unique PSMS
3
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{translation on same strand (frameshift candidate)}
Candidate nov_psm6_131 In bact CP040530.1
Seq (len = 21 ):
MITIEQLKDVKERTDALRRYL
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|78003|1|1896075-1896165
Transkriptom
2.0% of gene length expressed over median expression of contig.
ŝ
5.482364310132033
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 99 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_132 In bact CP040530.1
Seq (len = 19 ):
MTFLTMYMLYWKKPKPKIK
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|52364|1|1334477-1334573
Transkriptom
12.0% of gene length expressed over median expression of contig.
ŝ
2.0618139624940945
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 5 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_133 In bact CP040530.1
Seq (len = 15 ):
ISGKQGVMVSYFRAT
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|446784|-1|1816995-1817043
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9079815292472027
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_134 In bact CP040530.1
Seq (len = 26 ):
MENILLNLFAHSPNLLTEKHGNIERC
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|117321|1|2781635-2781716
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.715118285344547
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 27 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_135 In anaero CP036345.1
Seq (len = 30 ):
MLFLKLLKADLILINMIITGYLKIWKITKR
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|244932|-1|794045-794147
Transkriptom
44.0% of gene length expressed over median expression of contig.
ŝ
1.6185840571500232
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 17 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_136 In lacto CP039121.1
Seq (len = 14 ):
GLANKNHGHLASQR
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|330688|-1|145369-145411
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.356547323513812
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_137 In lacto CP039121.1
Seq (len = 32 ):
LQFSGDSCFFTKVENRDAWTDGGRRYWEGGSR
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|195021|-1|2787605-2787782
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.7569619513137056
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_138 In ery NZ_CP036346.1
Seq (len = 9 ):
IAPRILKKY
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|213266|1|3206504-3206594
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.294992040666664
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_139 In ecoli U00096.3
Seq (len = 60 ):
MRLGIAFFVTRKRIYTSPKNFACLFLGKRELFSNLHYKFRCHCFGIHRSPKCLYLRHESI
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|115782|1|3167898-3168096
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6155868438606245
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_140 In blautia CP039126.1
Seq (len = 48 ):
ITDSPGRLDLNRCLQILQLFSQIREIDPHHAHLCFCIKSPNLLHELFG
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|147195|1|3974528-3974807
Transkriptom
82.0% of gene length expressed over median expression of contig.
ŝ
2.3764061681465805
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_141 In bifi AE014295.3
Seq (len = 239 ):
MVGFGLCLVKNRARFLPCKLGDVLLAGQELCLFVGVPDHVGCAALCGGDDGVGLGLCRFQTALGLAHEGGGALQLHRQHFLQLGKLVGEFVAVNLHHAGGEYAGLRFAQCRLELVDDVIHRGEFLVALDRGRVVVRGFSQVGHFVHERGANAGGLSGLSLCPGLLSCLGLRFGLHLCRSRGRRGGRRSGENIGLFGGCRRGLRRRGRFRGGRLRSGRCGVRIRFGQIDVSSRVVIAHSH
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|73991|-1|1215231-1216272
Transkriptom
99.0% of gene length expressed over median expression of contig.
ŝ
2.2614836912846004
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
DNA-directed RNA polymerase specialized sigma subunit [Clostridium sp. SY8519]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein PMF13cell1_01876 [Blautia producta] hypothetical protein EV205_12445 [Blautia coccoides] DNA-directed RNA polymerase specialized sigma subunit [Blautia coccoides] |
1.59e-26 | 100 | 100.000 | QBE96332 |
putative uncharacterized protein [Firmicutes bacterium CAG:424] |
1.25e-20 | 94 | 91.304 | CDC42892 |
hypothetical protein BLAHAN_06400 [Blautia hansenii DSM 20583] hypothetical protein HMPREF0992_00751 [Lachnospiraceae bacterium 6_1_63FAA] putative uncharacterized protein [Lachnospiraceae bacterium CAG:364] |
4.67e-20 | 96 | 82.979 | EEX20948 |
hypothetical protein SAMN02745158_00858 [Lactonifactor longoviformis DSM 17459] |
1.97e-19 | 98 | 79.167 | SHE54666 |
putative uncharacterized protein [Firmicutes bacterium CAG:227] |
2.14e-18 | 98 | 77.083 | CDC91757 |
hypothetical protein RSAG_02827 [Ruminococcus sp. 5_1_39BFAA] putative uncharacterized protein [Ruminococcus sp. CAG:9] Uncharacterised protein [Blautia obeum] Uncharacterised protein [Blautia wexlerae] Uncharacterised protein [Blautia obeum] |
2.13e-14 | 98 | 62.500 | EES75939 |
hypothetical protein RUMHYD_02748 [Blautia hydrogenotrophica DSM 10507] putative uncharacterized protein [Blautia hydrogenotrophica CAG:147] Uncharacterised protein [Blautia hydrogenotrophica] Uncharacterised protein [uncultured Blautia sp.] |
2.6e-14 | 98 | 69.388 | EEG48344 |
uncharacterized protein BN552_00984 [Blautia sp. CAG:237] |
4.6e-14 | 100 | 59.184 | CDB78743 |
Uncharacterised protein [Fusicatenibacter saccharivorans] |
5.23e-14 | 84 | 78.049 | CUP17284 |
putative uncharacterized protein [Blautia sp. CAG:37] Uncharacterised protein [Fusicatenibacter saccharivorans] Uncharacterised protein [Fusicatenibacter saccharivorans] |
5.78e-14 | 84 | 78.049 | CDE64718 |
hypothetical protein RUMOBE_03249 [Blautia obeum ATCC 29174] uncharacterized protein BN639_00681 [Ruminococcus obeum CAG:39] Uncharacterised protein [Blautia obeum] Uncharacterised protein [uncultured Ruminococcus sp.] Uncharacterised protein [Blautia obeum] |
6.46e-14 | 98 | 60.417 | EDM86143 |
hypothetical protein CK5_20400 [Blautia obeum A2-162] Uncharacterised protein [uncultured Ruminococcus sp.] |
6.68e-14 | 98 | 60.417 | CBL23414 |
Uncharacterised protein [uncultured Blautia sp.] |
6.68e-14 | 98 | 62.500 | SCH43582 |
putative uncharacterized protein [Blautia sp. CAG:52] putative uncharacterized protein [Roseburia sp. CAG:471] Uncharacterised protein [uncultured Blautia sp.] |
6.75e-14 | 84 | 73.171 | CDB19896 |
putative uncharacterized protein [Ruminococcus sp. CAG:60] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Ruminococcus sp.] Uncharacterised protein [uncultured Clostridium sp.] |
1.14e-13 | 98 | 62.500 | CCY32428 |
putative uncharacterized protein [Ruminococcus sp. CAG:17] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Blautia sp.] |
1.68e-13 | 98 | 58.333 | CCY96971 |
uncharacterized protein BN568_01760 [Blautia sp. CAG:257] |
2.05e-13 | 98 | 58.333 | CDA05273 |
putative uncharacterized protein [Firmicutes bacterium CAG:646] |
2.09e-13 | 98 | 66.667 | CCZ33500 |
hypothetical protein BRYFOR_09498 [Marvinbryantia formatexigens DSM 14469] hypothetical protein SAMN05660368_03259 [Marvinbryantia formatexigens] |
2.72e-13 | 86 | 73.810 | EET58574 |
unnamed protein product hypothetical protein CK1_32580 [Ruminococcus sp. SR1/5] Uncharacterised protein [uncultured Blautia sp.] hypothetical protein SAMN02910433_00698 [Blautia sp. SF-50] Uncharacterised protein [Blautia luti] hypothetical protein HMPREF1547_02504 [Blautia sp. KLE 1732] |
2.72e-13 | 98 | 58.333 | WP_015526890 |
Uncharacterised protein [uncultured Clostridium sp.] |
3.96e-13 | 86 | 73.810 | SCH67232 |
MULTISPECIES: hypothetical protein [Bacteria] hypothetical protein C807_01942 [Lachnospiraceae bacterium 28-4] hypothetical protein D6D47_27955 [bacterium 1XD8-92] |
4.54e-12 | 96 | 63.830 | WP_016291684 |
Uncharacterised protein [uncultured Clostridium sp.] |
4.84e-12 | 98 | 60.417 | SCJ70719 |
putative uncharacterized protein [Roseburia sp. CAG:182] |
6.73e-12 | 88 | 67.442 | CDF43509 |
hypothetical protein HMPREF0373_02276 [Eubacterium ramulus ATCC 29099] putative uncharacterized protein [Roseburia sp. CAG:50] Uncharacterised protein [Eubacterium ramulus] |
7.69e-12 | 90 | 63.636 | ERK43710 |
putative uncharacterized protein [Dorea sp. CAG:317] |
1.38e-11 | 88 | 60.465 | CDD06996 |
putative uncharacterized protein [Roseburia sp. CAG:45] Uncharacterised protein [uncultured Roseburia sp.] |
1.68e-11 | 90 | 63.636 | CDC12085 |
putative uncharacterized protein [Clostridium sp. CAG:510] |
1.69e-11 | 98 | 62.500 | CDA68556 |
Uncharacterised protein [uncultured Clostridium sp.] |
3.43e-11 | 90 | 61.364 | SCI33929 |
hypothetical protein AMURIS_02282 [Acetatifactor muris] |
3.5e-11 | 90 | 65.909 | SOY29561 |
hypothetical protein CLOSCI_02270 [[Clostridium] scindens ATCC 35704] hypothetical protein HMPREF0993_00673 [Lachnospiraceae bacterium 5_1_57FAA] hypothetical protein HDCHBGLK_00578 [[Clostridium] scindens ATCC 35704] |
5.04e-11 | 88 | 60.465 | EDS06655 |
uncharacterized protein BN724_01900 [Clostridium sp. CAG:590] |
5.31e-11 | 92 | 55.556 | CCX88511 |
Uncharacterised protein [uncultured Clostridium sp.] |
5.67e-11 | 82 | 70.000 | SCG89478 |
hypothetical protein CC1_14530 [Coprococcus catus GD/7] |
5.67e-11 | 100 | 59.184 | CBK80234 |
putative uncharacterized protein [Dorea sp. CAG:105] |
6.49e-11 | 88 | 55.814 | CCX73115 |
hypothetical protein C8E03_11455 [Lachnotalea glycerini] |
6.68e-11 | 98 | 60.417 | PXV85977 |
putative uncharacterized protein [Roseburia sp. CAG:100] |
8.06e-11 | 88 | 65.116 | CDF46016 |
hypothetical protein C818_03624 [Lachnospiraceae bacterium MD308] |
9.02e-11 | 90 | 56.818 | EOS68275 |
hypothetical protein C823_01980 [Eubacterium plexicaudatum ASF492] |
9.61e-11 | 90 | 61.364 | EMZ28447 |
putative uncharacterized protein [Firmicutes bacterium CAG:56] Uncharacterised protein [uncultured Ruminococcus sp.] Uncharacterised protein [uncultured Ruminococcus sp.] |
9.82e-11 | 86 | 66.667 | CDA64059 |
hypothetical protein RHS_0258 [Robinsoniella sp. RHS] hypothetical protein DSM106044_01009 [Robinsoniella peoriensis] |
9.93e-11 | 98 | 58.333 | KLU74163 |
hypothetical protein [Lachnospiraceae bacterium] |
1.33e-10 | 94 | 60.870 | HBA68117 |
hypothetical protein C806_00217 [Lachnospiraceae bacterium 3-1] |
1.86e-10 | 90 | 61.364 | EOS27249 |
Uncharacterised protein [uncultured Eubacterium sp.] Uncharacterised protein [uncultured Ruminococcus sp.] |
2.13e-10 | 88 | 55.814 | SCH33250 |
hypothetical protein lbkm_4263 [Lachnospiraceae bacterium KM106-2] |
2.29e-10 | 86 | 66.667 | BBF45496 |
hypothetical protein C817_03442 [Dorea sp. 5-2] |
2.37e-10 | 88 | 58.140 | EOS78919 |
hypothetical protein C810_04478 [Lachnospiraceae bacterium A2] |
4.05e-10 | 90 | 59.091 | EOS42608 |
hypothetical protein SAMN05661086_01875 [[Clostridium] populeti] |
4.78e-10 | 86 | 66.667 | SFR81205 |
hypothetical protein DORFOR_01399 [Dorea formicigenerans ATCC 27755] hypothetical protein HMPREF9457_01702 [Dorea formicigenerans 4_6_53AFAA] putative uncharacterized protein [Dorea formicigenerans CAG:28] Uncharacterised protein [uncultured Dorea sp.] Uncharacterised protein [Dorea formicigenerans] |
5.01e-10 | 88 | 58.140 | EDR47433 |
hypothetical protein CLOHYLEM_05511 [[Clostridium] hylemonae DSM 15053] hypothetical protein HMPREF0980_02086 [Dorea sp. D27] hypothetical protein LAJLEIBI_02875 [[Clostridium] hylemonae DSM 15053] |
5.23e-10 | 90 | 56.818 | EEG74254 |
hypothetical protein bpr_I2154 [Butyrivibrio proteoclasticus B316] hypothetical protein SAMN02910371_03448 [Butyrivibrio sp. INlla14] |
5.58e-10 | 100 | 57.143 | ADL34887 |
hypothetical protein C805_02839 [Eubacterium sp. 14-2] |
6.65e-10 | 90 | 56.818 | EOT24627 |
hypothetical protein HMPREF0490_00062 [Lachnospiraceae bacterium 6_1_37FAA] hypothetical protein HMPREF0987_00961 [Lachnospiraceae bacterium 9_1_43BFAA] hypothetical protein HMPREF1215_00067 [Coprococcus sp. HPP0074] hypothetical protein HMPREF1216_01482 [Coprococcus sp. HPP0048] hypothetical protein EDD74_10676 [Faecalimonas umbilicata] |
6.74e-10 | 90 | 56.818 | EGC76217 |
putative uncharacterized protein [Firmicutes bacterium CAG:194] |
6.86e-10 | 88 | 62.791 | CCZ28877 |
putative uncharacterized protein [Clostridium nexile CAG:348] |
6.96e-10 | 86 | 57.143 | CDC23451 |
hypothetical protein ROI_29230 [Roseburia intestinalis M50/1] putative uncharacterized protein [Roseburia intestinalis CAG:13] Uncharacterised protein [Roseburia intestinalis] hypothetical protein RIL182_00846 [Roseburia intestinalis L1-82] |
1.06e-09 | 86 | 59.524 | CBL09817 |
hypothetical protein ROSINTL182_08130 [Roseburia intestinalis L1-82] hypothetical protein RO1_03070 [Roseburia intestinalis XB6B4] |
1.07e-09 | 86 | 59.524 | EEV00005 |
hypothetical protein SAMN04487772_101176 [[Clostridium] polysaccharolyticum] |
1.16e-09 | 86 | 66.667 | SES64497 |
hypothetical protein SAMN02910453_2010 [Lachnospiraceae bacterium A10] |
1.23e-09 | 90 | 56.818 | SEJ07550 |
putative uncharacterized protein [Ruminococcus sp. CAG:55] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [[Ruminococcus] torques] |
1.33e-09 | 100 | 51.020 | CDC16453 |
hypothetical protein SAMN02910358_01490 [Lachnospiraceae bacterium XBB1006] |
1.42e-09 | 90 | 56.818 | SFQ30267 |
hypothetical protein SAMN02746066_02933 [Anaerosporobacter mobilis DSM 15930] |
1.5e-09 | 86 | 64.286 | SHM68479 |
putative uncharacterized protein [Roseburia sp. CAG:18] hypothetical protein M72_01411 [Roseburia faecis] Uncharacterised protein [Roseburia faecis] |
1.55e-09 | 88 | 58.140 | CCZ79424 |
Uncharacterised protein [[Ruminococcus] torques] |
1.58e-09 | 100 | 51.020 | CUQ86757 |
hypothetical protein COPCOM_03290 [Coprococcus comes ATCC 27758] |
1.58e-09 | 90 | 54.545 | EEG88582 |
UNVERIFIED_CONTAM: hypothetical protein C7383_1178 [Murimonas intestini] |
1.74e-09 | 76 | 67.568 | PWJ72538 |
hypothetical protein SAMN02910382_03473 [Butyrivibrio sp. TB] hypothetical protein SAMN04487884_106139 [Butyrivibrio fibrisolvens] |
1.87e-09 | 98 | 56.250 | SEQ57544 |
hypothetical protein [Lachnospiraceae bacterium XBB2008] hypothetical protein SAMN02910292_00618 [Lachnospiraceae bacterium XBB2008] |
1.94e-09 | 98 | 54.167 | WP_089854805 |
Uncharacterised protein [uncultured Clostridium sp.] |
2e-09 | 90 | 52.273 | SCH05569 |
hypothetical protein SAMN02910301_1765 [Lachnospiraceae bacterium XBD2001] |
2.29e-09 | 86 | 54.762 | SFT55479 |
hypothetical protein [Lachnospiraceae bacterium WCA-9-b2] |
3.09e-09 | 90 | 54.545 | MXP78520 |
hypothetical protein EV212_103221 [Frisingicoccus caecimuris] |
3.09e-09 | 98 | 56.250 | TCO85499 |
putative uncharacterized protein [Clostridium sp. CAG:91] Uncharacterised protein [uncultured Clostridium sp.] |
3.23e-09 | 82 | 65.000 | CDD00652 |
hypothetical protein SAMN04487928_1145 [Butyrivibrio proteoclasticus] |
3.23e-09 | 100 | 53.061 | SFP97732 |
hypothetical protein [Roseburia inulinivorans] Uncharacterised protein [Roseburia inulinivorans] hypothetical protein [Roseburia sp.] |
3.36e-09 | 86 | 57.143 | WP_070102896 |
hypothetical protein [Roseburia inulinivorans] hypothetical protein ROSEINA2194_02482 [Roseburia inulinivorans DSM 16841] putative uncharacterized protein [Roseburia inulinivorans CAG:15] hypothetical protein BHW47_06670 [Roseburia inulinivorans] hypothetical protein DWY96_10710 [Roseburia inulinivorans] hypothetical protein DWY29_10815 [Roseburia inulinivorans] |
3.44e-09 | 86 | 57.143 | WP_007886736 |
hypothetical protein [bacterium C-53] |
3.66e-09 | 92 | 53.333 | WP_147412423 |
hypothetical protein SAMN02910398_02696 [Butyrivibrio sp. YAB3001] |
3.85e-09 | 96 | 55.319 | SFC61243 |
uncharacterized protein BN524_01913 [Coprococcus comes CAG:19] Uncharacterised protein [Coprococcus comes] Uncharacterised protein [uncultured Coprococcus sp.] Uncharacterised protein [Coprococcus comes] Uncharacterised protein [Coprococcus comes] |
4.17e-09 | 82 | 57.500 | CDB85128 |
hypothetical protein EDC18_10679 [Natranaerovirga pectinivora] |
4.34e-09 | 94 | 52.174 | TCT14282 |
hypothetical protein SAMN02910417_00420 [Eubacterium oxidoreducens] |
4.63e-09 | 96 | 51.064 | SDB06084 |
uncharacterized protein BN572_01524 [Clostridium sp. CAG:264] Uncharacterised protein [uncultured Coprococcus sp.] |
4.84e-09 | 98 | 54.167 | CCY60419 |
hypothetical protein CLOL250_02873 [Clostridium sp. L2-50] |
6.96e-09 | 98 | 54.167 | EDO56438 |
uncharacterized protein BN596_01161 [Roseburia sp. CAG:303] |
7.51e-09 | 88 | 58.140 | CDE52982 |
putative uncharacterized protein [Roseburia sp. CAG:197] |
8.02e-09 | 88 | 55.814 | CDA25068 |
hypothetical protein D7X88_11835 [bacterium C-53] |
8.34e-09 | 92 | 53.333 | RKJ09274 |
hypothetical protein SAMN02745136_04166 [Anaerocolumna jejuensis DSM 15929] hypothetical protein SAMN02745217_03412 [Anaerocolumna xylanovorans DSM 12503] |
8.49e-09 | 86 | 59.524 | SHL13682 |
putative uncharacterized protein [Anaerostipes sp. CAG:276] |
8.68e-09 | 86 | 64.286 | CDC34029 |
putative uncharacterized protein [Firmicutes bacterium CAG:534] |
9.36e-09 | 84 | 63.415 | CDD46661 |
putative uncharacterized protein [Clostridium sp. CAG:167] |
1.26e-08 | 94 | 50.000 | CCZ90322 |
hypothetical protein EV209_0639 [Cuneatibacter caecimuris] |
1.27e-08 | 92 | 55.556 | RZT02520 |
hypothetical protein EDD66_10611 [Mobilisporobacter senegalensis] |
1.36e-08 | 86 | 59.524 | ROR27317 |
hypothetical protein HMPREF9477_01848 [Lachnospiraceae bacterium 2_1_46FAA] |
1.41e-08 | 86 | 52.381 | EGG80989 |
Uncharacterised protein [uncultured Clostridium sp.] |
1.48e-08 | 82 | 65.000 | SCH78502 |
putative uncharacterized protein [Firmicutes bacterium CAG:65] Uncharacterised protein [uncultured Clostridium sp.] |
1.57e-08 | 73 | 69.444 | CDB01905 |
hypothetical protein [Lachnospiraceae bacterium A4] |
1.6e-08 | 88 | 55.814 | WP_157496388 |
hypothetical protein C804_03300 [Lachnospiraceae bacterium A4] |
1.61e-08 | 88 | 55.814 | EOS30277 |
hypothetical protein SAMN02910276_02725 [Butyrivibrio sp. Su6] |
1.77e-08 | 100 | 51.020 | SEG37996 |
hypothetical protein RUMTOR_01188 [[Ruminococcus] torques ATCC 27756] hypothetical protein HMPREF1026_01729 [Lachnospiraceae bacterium 8_1_57FAA] hypothetical protein HMPREF1025_01039 [Lachnospiraceae bacterium 3_1_46FAA] hypothetical protein HMPREF0990_02419 [Lachnospiraceae bacterium 1_1_57FAA] putative uncharacterized protein [[Ruminococcus] torques CAG:61] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [uncultured Ruminococcus sp.] |
1.82e-08 | 82 | 57.500 | EDK24459 |
hypothetical protein EDD59_10325 [Muricomes intestini] |
2.64e-08 | 88 | 51.163 | TCS81610 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_142 In bact CP040530.1
Seq (len = 23 ):
LHRMHVGGAVKKPLEKTLYWCHK
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|283181|-1|5802150-5802276
Transkriptom
6.0% of gene length expressed over median expression of contig.
ŝ
1.8998593011338474
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_143 In bact CP040530.1
Seq (len = 90 ):
MICVCPAQCFHHQRMHTGIIIRGKTSHCFFLFLRIVLIVMQSNRIISRYTSCAANNLIRARPMQEVRYRHKMQTKKNPAGHSFAASHRQS
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|248022|1|5856883-5857300
Transkriptom
74.0% of gene length expressed over median expression of contig.
ŝ
2.399753349435506
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 5 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_144 In lacto CP039121.1
Seq (len = 13 ):
ISGLNFGTISHRV
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|259780|-1|1553600-1553729
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.721246399047171
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_145 In lacto CP039121.1
Seq (len = 57 ):
MGGVYYIWLFVVCTIYVFDVISRIILYARPRSFSYLRSQWRVRADCWDIHAVQSTGD
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|20335|1|360196-360466
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7816395782294647
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_146 In lacto CP039121.1
Seq (len = 20 ):
IRETKLQFRDAHFHGYLRYG
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|182054|-1|3023467-3023533
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.818632873410645
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein ANACAC_00612 [Anaerostipes caccae DSM 14662] |
1.82e-32 | 100 | 100.000 | EDR98562 |
hypothetical protein [Anaerostipes sp. AF04-45] |
1.94e-20 | 96 | 74.545 | WP_158565688 |
hypothetical protein AR1Y2_2955 [Anaerostipes rhamnosivorans] |
1.19e-19 | 96 | 70.909 | QCP36409 |
hypothetical protein HMPREF1011_03039 [Anaerostipes caccae] putative uncharacterized protein [Anaerostipes sp. CAG:276] |
3.12e-12 | 93 | 52.830 | EFV21249 |
putative uncharacterized protein [Firmicutes bacterium CAG:270] |
2.26e-10 | 91 | 51.923 | CDD72797 |
hypothetical protein [Anaerostipes hadrus] hypothetical protein HMPREF0369_01033 [Anaerostipes hadrus DSM 3319] hypothetical protein F2Y14_12720 [Anaerostipes hadrus] Uncharacterised protein [Anaerostipes hadrus] Uncharacterised protein [Anaerostipes hadrus] |
4.87e-10 | 86 | 53.061 | WP_009203419 |
MULTISPECIES: hypothetical protein [Clostridiales] hypothetical protein CLOSS21_02508 [Clostridium sp. SS2/1] hypothetical protein CL2_00780 [Anaerostipes hadrus] |
1.96e-09 | 86 | 51.020 | WP_008393593 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_147 In ecoli U00096.3
Seq (len = 95 ):
SSAASSSALKSRSFTSGIFSAEIKPITEYAMIIMAIGYQDSVMVQKIPARIGPKPEAIRPPISLEIAIRVKRFLQPNISAMVMFSRANNPSTAQL
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|61012|1|1631047-1631332
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.260691423843411
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_148 In ecoli U00096.3
Seq (len = 68 ):
EYEMILRTVRALISLTVRAACKITTSNKPAKSHRDKSKQTNSSKEIYQYYSSTGNIHFCHLLSLPLCV
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|56375|1|1517023-1517227
Transkriptom
46.0% of gene length expressed over median expression of contig.
ŝ
2.1172857723797742
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_149 In ecoli U00096.3
Seq (len = 67 ):
MVSKTSRKKTEACGKAVILAKFQCGIIAKPNTTIIPTLTTTIGPEILNSNRSPPDAIATSTAKIATL
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|202092|-1|3700981-3701212
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9863203027088072
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104] |
3.41e-18 | 56 | 75.472 | CQF16182 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_150 In clostri CP040626.1
Seq (len = 41 ):
MLLEHLNLQLFHLYWHLKHHLQQLCLPFQLLQLQLSSIHRM
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|451456|-1|1239767-1239932
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.159684758184563
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein EO53_10770 [Escherichia coli str. K-12 substr. MG1655] hypothetical protein RR31_07545 [Escherichia coli] hypothetical protein SH05_11300 [Escherichia coli K-12] hypothetical protein Y979_07940 [Escherichia coli str. Sanji] hypothetical protein BL257_07150 [Escherichia coli str. K-12 substr. W3110] hypothetical protein HMPREF1616_04540 [Escherichia coli 908658] |
1.27e-39 | 96 | 100.000 | AIZ91444 |
hypothetical protein AM262_18300 [Escherichia coli] |
3.76e-39 | 96 | 98.462 | KQI96087 |
hypothetical protein [Escherichia coli] hypothetical protein NRG857_07133 [Escherichia coli O83:H1 str. NRG 857C] hypothetical protein LI75_10250 [Escherichia coli FAP1] hypothetical protein AO055_09280 [Escherichia coli O157:H7] hypothetical protein C2566_11000 [Escherichia coli B] hypothetical protein AX202_08355 [Escherichia coli JJ1887] hypothetical protein A0259_11270 [Shigella sp. PAMC 28760] Hypothetical protein WLH_00177 [Escherichia coli O25b:H4] hypothetical protein HMPREF0986_05260 [Escherichia coli 4_1_47FAA] hypothetical protein WCA_02295 [Escherichia coli KTE2] hypothetical protein WEK_01852 [Escherichia coli KTE26] hypothetical protein A139_01224 [Escherichia coli KTE181] hypothetical protein A15I_01380 [Escherichia coli KTE204] hypothetical protein A15Q_01720 [Escherichia coli KTE208] hypothetical protein A171_00988 [Escherichia coli KTE213] hypothetical protein A17U_00434 [Escherichia coli KTE228] hypothetical protein A195_01186 [Escherichia coli KTE235] hypothetical protein A1UW_01515 [Escherichia coli KTE80] hypothetical protein A1W1_01648 [Escherichia coli KTE83] hypothetical protein A1Y3_02375 [Escherichia coli KTE116] hypothetical protein A1S9_03169 [Escherichia coli KTE50] hypothetical protein A1SG_02634 [Escherichia coli KTE54] hypothetical protein A1Y1_01497 [Escherichia coli KTE115] hypothetical protein A1YQ_02045 [Escherichia coli KTE140] hypothetical protein A31C_02153 [Escherichia coli KTE158] hypothetical protein A13Q_01867 [Escherichia coli KTE190] hypothetical protein A15E_02131 [Escherichia coli KTE202] hypothetical protein WI7_01418 [Escherichia coli KTE105] hypothetical protein WIK_01630 [Escherichia coli KTE122] hypothetical protein WIO_01568 [Escherichia coli KTE125] hypothetical protein WIQ_01626 [Escherichia coli KTE128] hypothetical protein WKU_01516 [Escherichia coli KTE177] hypothetical protein WGM_01614 [Escherichia coli KTE82] hypothetical protein WGY_01544 [Escherichia coli KTE95] hypothetical protein WC9_01506 [Escherichia coli KTE231] hypothetical protein A15A_01900 [Escherichia coli KTE200] hypothetical protein A1U9_01609 [Escherichia coli KTE68] hypothetical protein A1YE_02310 [Escherichia coli KTE127] hypothetical protein A1YK_04078 [Escherichia coli KTE134] hypothetical protein A31O_02133 [Escherichia coli KTE170] hypothetical protein G434_00452 [Escherichia sp. KTE172] hypothetical protein WAS_02307 [Escherichia coli KTE1] hypothetical protein A17O_02793 [Escherichia coli KTE225] hypothetical protein G689_01975 [Escherichia coli HVH 10 (4-6832164)] hypothetical protein G698_01558 [Escherichia coli HVH 22 (4-2258986)] hypothetical protein G705_00670 [Escherichia coli HVH 29 (4-3418073)] hypothetical protein G718_02442 [Escherichia coli HVH 43 (4-2173468)] hypothetical protein G719_01546 [Escherichia coli HVH 44 (4-2298570)] hypothetical protein G720_01675 [Escherichia coli HVH 45 (4-3129918)] hypothetical protein G732_01626 [Escherichia coli HVH 63 (4-2542528)] hypothetical protein G735_01665 [Escherichia coli HVH 69 (4-2837072)] hypothetical protein G747_01483 [Escherichia coli HVH 85 (4-0792144)] hypothetical protein G750_01521 [Escherichia coli HVH 88 (4-5854636)] hypothetical protein G767_01686 [Escherichia coli HVH 106 (4-6881831)] hypothetical protein G771_01740 [Escherichia coli HVH 110 (4-6978754)] hypothetical protein G774_01572 [Escherichia coli HVH 113 (4-7535473)] hypothetical protein G781_01675 [Escherichia coli HVH 119 (4-6879578)] hypothetical protein G784_01572 [Escherichia coli HVH 122 (4-6851606)] hypothetical protein G789_01497 [Escherichia coli HVH 130 (4-7036876)] hypothetical protein G792_02640 [Escherichia coli HVH 134 (4-6073441)] hypothetical protein G793_01565 [Escherichia coli HVH 135 (4-4449320)] hypothetical protein G791_00250 [Escherichia coli HVH 133 (4-4466519)] hypothetical protein G798_01624 [Escherichia coli HVH 140 (4-5894387)] hypothetical protein G803_02913 [Escherichia coli HVH 145 (4-5672112)] hypothetical protein G809_01600 [Escherichia coli HVH 151 (4-5755573)] hypothetical protein G821_02762 [Escherichia coli HVH 163 (4-4697553)] hypothetical protein G823_01578 [Escherichia coli HVH 167 (4-6073565)] hypothetical protein G828_03039 [Escherichia coli HVH 173 (3-9175482)] hypothetical protein G835_01689 [Escherichia coli HVH 183 (4-3205932)] hypothetical protein G834_01569 [Escherichia coli HVH 182 (4-0985554)] hypothetical protein G841_01560 [Escherichia coli HVH 189 (4-3220125)] hypothetical protein G858_01111 [Escherichia coli HVH 206 (4-3128229)] hypothetical protein G860_01627 [Escherichia coli HVH 208 (4-3112292)] hypothetical protein G867_01730 [Escherichia coli HVH 215 (4-3008371)] hypothetical protein G874_01594 [Escherichia coli HVH 223 (4-2976528)] hypothetical protein G891_01547 [Escherichia coli KOEGE 68 (182a)] hypothetical protein G890_01744 [Escherichia coli KOEGE 62 (175a)] hypothetical protein G894_01217 [Escherichia coli KOEGE 73 (195a)] hypothetical protein G938_01605 [Escherichia coli UMEA 3200-1] hypothetical protein G813_01626 [Escherichia coli HVH 155 (4-4509048)] hypothetical protein G916_01476 [Escherichia coli UMEA 3144-1] hypothetical protein HMPREF1620_02290 [Escherichia coli 909945-2] hypothetical protein HMPREF1593_03997 [Escherichia coli 907391] hypothetical protein HMPREF1610_04407 [Escherichia coli 908555] hypothetical protein G794_01559 [Escherichia coli HVH 136 (4-5970458)] hypothetical protein K427_27925 [Escherichia coli MP1] hypothetical protein AF44_00293 [Escherichia coli MGH 58] hypothetical protein SC80_15050 [Escherichia coli RS218] hypothetical protein T638_15940 [Escherichia coli MRSN 10204] hypothetical protein CR63_07090 [Escherichia coli NB8] hypothetical protein ERYG_05768 [Escherichia coli M114] hypothetical protein AZE29_16965 [Escherichia coli APEC O2] hypothetical protein BFF49_07625 [Shigella sp. FC2045] hypothetical protein BFF50_09355 [Shigella sp. FC2928] hypothetical protein ECNA114_022550 [Escherichia coli NA114] hypothetical protein UG58_14825 [Escherichia coli O25b:H4-ST131] hypothetical protein L241_03620 [Escherichia coli O55:H7 str. USDA 5905] hypothetical protein H260_09730 [Escherichia coli O157:H7 str. TW14313] hypothetical protein H474_09465 [Escherichia coli O55:H7 str. TB182A] hypothetical protein H644_10820 [Escherichia coli O157:H7 str. EC1825] hypothetical protein AWM77_23925 [Escherichia coli ATCC 25922] |
3.84e-39 | 96 | 98.462 | WP_001306888 |
hypothetical protein A8F81_06195 [Escherichia coli] |
5.61e-39 | 96 | 96.923 | OWD04881 |
hypothetical protein WRSd3_04122 [Shigella dysenteriae WRSd3] hypothetical protein A0V00_14485 [Shigella dysenteriae] |
6.96e-39 | 96 | 96.923 | ESU76945 |
hypothetical protein PU51_09330 [Escherichia coli] |
8.86e-39 | 96 | 96.923 | KHH80580 |
hypothetical protein AC067_16305 [Escherichia coli] hypothetical protein AWF70_11645 [Escherichia coli] |
1.07e-38 | 96 | 96.923 | KOA33210 |
hypothetical protein A311_02080 [Escherichia coli KTE146] Uncharacterised protein [Escherichia coli] Uncharacterised protein [Escherichia coli] Uncharacterised protein [Escherichia coli] Uncharacterised protein [Escherichia coli] |
1.33e-38 | 96 | 96.923 | ELG89413 |
hypothetical protein BMR20_14735 [Escherichia coli] |
1.52e-38 | 96 | 96.923 | PGF70051 |
hypothetical protein A8A11_21850 [Escherichia coli] |
1.71e-38 | 96 | 96.923 | PMD75754 |
hypothetical protein BK347_14625 [Escherichia coli] hypothetical protein BK377_22335 [Escherichia coli] |
1.98e-38 | 96 | 98.462 | OJP76064 |
hypothetical protein A9K64_11345 [Escherichia coli] hypothetical protein HMPREF1592_00507 [Escherichia coli 907357] hypothetical protein HMPREF1609_04589 [Escherichia coli 908541] hypothetical protein BW72_04885 [Escherichia coli O78:H12 str. 00-3279] hypothetical protein SU67_20910 [Escherichia coli O139:H28 str. E24377A] hypothetical protein A8O33_21960 [Escherichia coli O157:H43] hypothetical protein EC161867_00292 [Escherichia coli O145:H25] |
2.72e-38 | 96 | 96.923 | ANJ35115 |
hypothetical protein APU13_03795 [Escherichia coli] |
3.31e-38 | 96 | 96.923 | KSY87371 |
hypothetical protein RG64_10185 [Escherichia coli] |
3.31e-38 | 96 | 96.923 | APL42960 |
hypothetical protein A8F87_22785 [Escherichia coli] |
3.74e-38 | 96 | 96.923 | OWC81658 |
hypothetical protein AWE92_05560 [Escherichia coli] hypothetical protein AWH01_05645 [Escherichia coli] hypothetical protein A8G20_11975 [Escherichia coli] hypothetical protein A8M52_18435 [Escherichia coli] hypothetical protein A8M46_18700 [Escherichia coli] |
4.81e-38 | 96 | 96.923 | KUV59976 |
hypothetical protein AWF54_09270 [Escherichia coli] |
5.25e-38 | 96 | 96.923 | KUW03411 |
hypothetical protein AAW09_14670 [Escherichia coli] |
5.43e-38 | 96 | 96.923 | KZO70700 |
hypothetical protein AWG62_05475 [Escherichia coli] hypothetical protein AWG68_02130 [Escherichia coli] hypothetical protein BMT57_20650 [Escherichia coli] hypothetical protein BFD31_21360 [Escherichia coli] |
5.86e-38 | 96 | 96.923 | KZI29020 |
hypothetical protein AWF29_19205 [Escherichia coli] |
8.7e-38 | 96 | 96.923 | KUU69647 |
hypothetical protein CF58_14495 [Escherichia coli] hypothetical protein CF59_14460 [Escherichia coli] hypothetical protein CF60_14195 [Escherichia coli] |
9.25e-38 | 94 | 96.875 | AHM43691 |
hypothetical protein HMPREF9547_03933 [Escherichia coli MS 175-1] hypothetical protein HMPREF9541_01648 [Escherichia coli MS 116-1] hypothetical protein HMPREF9543_02006 [Escherichia coli MS 146-1] hypothetical protein PU70_15895 [Escherichia coli] hypothetical protein ARC88_01050 [Escherichia coli] |
1.03e-37 | 93 | 98.413 | EFJ64880 |
hypothetical protein AWG57_19055 [Escherichia coli] |
1.25e-37 | 96 | 96.923 | KZH49608 |
hypothetical protein VK74_04610 [Escherichia coli] hypothetical protein HMPREF9549_00843 [Escherichia coli MS 185-1] hypothetical protein HMPREF9553_00636 [Escherichia coli MS 200-1] hypothetical protein HMPREF9552_04115 [Escherichia coli MS 198-1] hypothetical protein HMPREF9534_00423 [Escherichia coli MS 69-1] hypothetical protein HMPREF9540_01026 [Escherichia coli MS 115-1] hypothetical protein HMPREF9548_00078 [Escherichia coli MS 182-1] hypothetical protein HMPREF9530_03961 [Escherichia coli MS 21-1] hypothetical protein HMPREF9550_01317 [Escherichia coli MS 187-1] hypothetical protein HMPREF9535_01031 [Escherichia coli MS 78-1] hypothetical protein HMPREF9539_00251 [Escherichia coli MS 110-3] hypothetical protein HMPREF9544_04938 [Escherichia coli MS 153-1] hypothetical protein HMPREF9532_00304 [Escherichia coli MS 57-2] hypothetical protein HMPREF9533_00757 [Escherichia coli MS 60-1] |
2.92e-37 | 93 | 96.825 | AKC11932 |
hypothetical protein AKK22_11830 [Escherichia coli] hypothetical protein BW73_34215 [Escherichia coli O111:NM str. 01-3076] hypothetical protein BU59_19695 [Escherichia coli O69:H11 str. 07-3763] hypothetical protein BU56_16770 [Escherichia coli O145:H25 str. 07-3858] hypothetical protein BU55_00080 [Escherichia coli O146:H21 str. 2010C-3325] hypothetical protein BU53_26780 [Escherichia coli O91:H21 str. 2009C-3740] hypothetical protein BU57_28775 [Escherichia coli O121:H19 str. 2011C-3609] hypothetical protein BU58_28500 [Escherichia coli O26:H11 str. 2011C-3274] hypothetical protein BU64_27420 [Escherichia coli O128:H2 str. 2011C-3317] hypothetical protein BU63_00925 [Escherichia coli O118:H16 str. 07-4255] |
6.39e-37 | 94 | 95.312 | ALL93444 |
hypothetical protein PU22_17880 [Escherichia coli] hypothetical protein PU29_24585 [Escherichia coli] |
8.55e-37 | 96 | 95.385 | KHI57325 |
hypothetical protein A191_04036 [Escherichia coli KTE233] |
1.1e-36 | 91 | 98.387 | ELD65054 |
unnamed protein product hypothetical protein AAF13_10260 [Escherichia coli O104:H4 str. C227-11] hypothetical protein ABE81_09090 [Shigella boydii] hypothetical protein AD867_10175 [Shigella flexneri 2a] hypothetical protein AD871_07980 [Shigella flexneri 4c] hypothetical protein I51_08360 [Escherichia coli O91 str. RM7190] hypothetical protein ECC69171_21975 [Escherichia coli C691-71 (14b)] hypothetical protein BFF42_21700 [Shigella sp. FC1661] hypothetical protein BFF48_22010 [Shigella sp. FC1882] hypothetical protein BFF47_22590 [Shigella sp. FC1764] hypothetical protein BFR10_20365 [Shigella sp. FC1180] hypothetical protein BFR11_21130 [Shigella sp. FC2383] hypothetical protein BFR12_22035 [Shigella sp. FC2833] hypothetical protein BGK49_20850 [Shigella sp. FC1544] hypothetical protein BGK52_21055 [Shigella sp. FC1056] hypothetical protein BGK53_17920 [Shigella sp. FC1139] hypothetical protein BHQ32_22505 [Shigella sp. FC2117] hypothetical protein BHQ33_22070 [Shigella sp. FC2125] hypothetical protein BHQ38_22450 [Shigella sp. FC2710] hypothetical protein BHQ36_21235 [Shigella sp. FC2531] hypothetical protein BHQ37_21070 [Shigella sp. FC2541] hypothetical protein BHQ39_21475 [Shigella sp. FC3196] hypothetical protein BHE85_22200 [Shigella sp. FC1567] hypothetical protein BHE87_21150 [Shigella sp. FC1708] hypothetical protein BHE88_21735 [Shigella sp. FC1737] conserved predicted protein [Escherichia coli O26:H11 str. 11368] |
2.15e-36 | 93 | 95.238 | WP_012817775 |
hypothetical protein GJ11_08845 [Escherichia coli] |
9.49e-36 | 93 | 93.651 | ANO88839 |
hypothetical protein BK264_23780 [Escherichia coli] hypothetical protein BK313_26845 [Escherichia coli] hypothetical protein BK317_20640 [Escherichia coli] |
1.88e-35 | 93 | 93.651 | OJL45096 |
hypothetical protein BU54_32495 [Escherichia coli O45:H2 str. 2010C-4211] |
2.27e-35 | 94 | 93.750 | KDV51336 |
hypothetical protein ARC82_20455 [Escherichia coli] |
6.28e-35 | 93 | 93.651 | KUH00471 |
hypothetical protein A0U97_09835 [Escherichia coli] hypothetical protein UN86_25580 [Escherichia coli] hypothetical protein UN87_21600 [Escherichia coli] hypothetical protein WQ92_10255 [Escherichia coli] hypothetical protein WQ77_17175 [Escherichia coli] |
8.17e-35 | 93 | 93.651 | ASJ43227 |
hypothetical protein A8M76_29120, partial [Escherichia coli] |
2.6e-32 | 82 | 98.214 | OWF29094 |
hypothetical protein PU06_26940 [Escherichia coli] |
2.26e-31 | 93 | 88.889 | KHJ12632 |
Uncharacterised protein [Escherichia coli] |
4.04e-30 | 91 | 87.097 | SRY14903 |
hypothetical protein BHF12_22685 [Escherichia coli] |
5.11e-29 | 75 | 98.039 | OEL77026 |
hypothetical protein BK278_24610 [Escherichia coli] hypothetical protein BK287_25300 [Escherichia coli] |
5.01e-27 | 75 | 96.078 | OJM27301 |
hypothetical protein BMT66_23370 [Escherichia coli] hypothetical protein BMT70_24295 [Escherichia coli] hypothetical protein BMT71_23270 [Escherichia coli] hypothetical protein A8A06_06825 [Escherichia coli] |
2.37e-25 | 84 | 82.456 | OOI63261 |
Uncharacterised protein [Escherichia coli] |
3.5e-25 | 72 | 97.959 | STG06709 |
hypothetical protein BMR22_14250 [Escherichia marmotae] hypothetical protein BMR23_00665 [Escherichia marmotae] |
5.32e-22 | 72 | 83.673 | PGF75527 |
hypothetical protein AAW06_05385 [Escherichia coli] |
3.22e-21 | 72 | 79.592 | KZO63975 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_151 In clostri CP040626.1
Seq (len = 10 ):
MDFLKKHFRI
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|313625|-1|3236017-3236119
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.6228152129185818
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] |
2.59e-28 | 100 | 79.104 | CNU71342 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_152 In clostri CP040626.1
Seq (len = 49 ):
LPEISNNFSLSTNPSSSICVAFKFFAHKGLKILSLNPDCFLTTSKADLF
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|233918|1|3453703-3453862
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.7714285581819587
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_153 In blautia CP039126.1
Seq (len = 97 ):
MTDFGPLIANPKSFILGAAAQLGIYSAYFLAIVLGFNGKAAAAISIIGGADGPTSIFLAGKLGQTNLMGPIAVAAYSYMSLVPIIQPPIMKLFTTEK
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|235674|-1|5908678-5908996
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
6.757657378975356
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_154 In blautia CP039126.1
Seq (len = 8 ):
MSSYFSLR
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|159412|1|4348522-4348609
Transkriptom
95.0% of gene length expressed over median expression of contig.
ŝ
1.9174539763316045
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_155 In bifi AE014295.3
Seq (len = 19 ):
MALDAASSGPGAGAINALR
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|52953|-1|2143809-2144034
Transkriptom
71.0% of gene length expressed over median expression of contig.
ŝ
1.8728952016351923
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_156 In bact CP040530.1
Seq (len = 36 ):
MNKKTEKKQEEAKGTKKTAQAKECKSSTSSKKTEKK
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|433692|-1|2148110-2148221
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
6.368218127052349
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
oxaloacetate decarboxylase beta subunit [Firmicutes bacterium CAG:646]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
oxaloacetate decarboxylase beta subunit [Firmicutes bacterium CAG:646] |
3.28e-55 | 100 | 95.876 | CCZ36005 |
oxaloacetate decarboxylase beta subunit [Blautia sp. CAG:52] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
5.1e-55 | 100 | 96.907 | CDB20066 |
oxaloacetate decarboxylase beta subunit [Roseburia sp. CAG:471] |
5.38e-55 | 100 | 96.907 | CDD99407 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. SG-772] sodium ion-translocating decarboxylase subunit beta [Blautia sp. SG-772] |
5.74e-55 | 100 | 96.907 | WP_106492286 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Blautia] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium BSM-380-WT-5A] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AM16-16B] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AM22-22LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF25-12LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF22-5LB] |
6.13e-55 | 100 | 96.907 | WP_117523449 |
sodium ion-translocating decarboxylase subunit beta [Blautia glucerasea] |
2.37e-54 | 100 | 95.876 | WP_156353369 |
sodium ion-translocating decarboxylase subunit beta [Blautia hydrogenotrophica] sodium ion-translocating decarboxylase, beta subunit [Blautia hydrogenotrophica DSM 10507] putative uncharacterized protein [Blautia hydrogenotrophica CAG:147] Glutaconyl-CoA decarboxylase subunit beta [Blautia hydrogenotrophica] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
5.2e-54 | 100 | 93.814 | WP_005945829 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Firmicutes sensu stricto (miscellaneous)] sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium AM10-47] sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium OM04-13BH] oxaloacetate decarboxylase beta subunit [Firmicutes bacterium CAG:227] |
6.3e-54 | 100 | 94.845 | WP_022303500 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Lactonifactor] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A5] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A4] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A3] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A2] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A1] |
6.81e-54 | 100 | 94.845 | WP_154258577 |
sodium ion-translocating decarboxylase subunit beta [Lactonifactor longoviformis] sodium ion-translocating decarboxylase subunit beta [Lactonifactor longoviformis] oxaloacetate decarboxylase, beta subunit [Lactonifactor longoviformis DSM 17459] |
6.89e-54 | 100 | 94.845 | WP_072850840 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF31-8BH] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF31-8BH] glutaconyl-CoA decarboxylase subunit beta [Blautia sp.] |
7.75e-54 | 100 | 94.845 | WP_117851886 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM42-11] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM42-11] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
8.82e-54 | 100 | 94.845 | WP_118578037 |
Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
1.04e-53 | 100 | 94.845 | SCH94434 |
glutaconyl-CoA decarboxylase subunit beta [Eubacterium sp.] |
1.13e-53 | 100 | 93.814 | HAX58949 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcaceae bacterium] Glutaconyl-CoA decarboxylase subunit beta [[Ruminococcus] torques] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] |
1.45e-53 | 100 | 94.845 | WP_148461987 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
1.6e-53 | 100 | 93.814 | WP_158420340 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase, beta subunit [Blautia obeum ATCC 29174] sodium ion-translocating decarboxylase, beta subunit [Blautia obeum A2-162] sodium ion-translocating decarboxylase beta subunit [Ruminococcus obeum CAG:39] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] sodium ion-translocating decarboxylase subunit beta [Blautia obeum] |
2.62e-53 | 100 | 94.845 | WP_005424527 |
sodium ion-translocating decarboxylase subunit beta [Blautia obeum] Glutaconyl-CoA decarboxylase subunit beta [Blautia obeum] |
2.68e-53 | 100 | 94.845 | WP_144369498 |
sodium ion-translocating decarboxylase subunit beta [Blautia producta] |
3.24e-53 | 100 | 94.845 | WP_018597973 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Lachnospiraceae] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-22] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-11LB] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-40] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-39] |
3.54e-53 | 100 | 93.814 | WP_117467933 |
sodium ion-translocating decarboxylase subunit beta [Blautia hansenii] sodium ion-translocating decarboxylase subunit beta [Blautia hansenii DSM 20583] hypothetical protein HMPREF0992_01863 [Lachnospiraceae bacterium 6_1_63FAA] putative uncharacterized protein [Lachnospiraceae bacterium CAG:364] |
3.54e-53 | 100 | 93.814 | WP_009247240 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. Marseille-P3201T] |
3.74e-53 | 100 | 93.814 | WP_072449421 |
sodium ion-translocating decarboxylase subunit beta [Blautia hansenii] |
3.94e-53 | 100 | 93.814 | WP_040351047 |
sodium ion-translocating decarboxylase subunit beta [Marvinbryantia formatexigens] sodium ion-translocating decarboxylase, beta subunit [Marvinbryantia formatexigens DSM 14469] oxaloacetate decarboxylase, beta subunit [Marvinbryantia formatexigens] |
5.05e-53 | 100 | 93.814 | WP_006864634 |
glutaconyl-CoA decarboxylase subunit beta [Blautia hansenii DSM 20583] |
5.63e-53 | 100 | 93.814 | EEX22662 |
sodium ion-translocating decarboxylase subunit beta [bacterium 1XD42-54] sodium ion-translocating decarboxylase subunit beta [bacterium 1XD42-54] |
5.92e-53 | 100 | 93.814 | WP_120391700 |
sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] sodium ion-translocating decarboxylase, beta subunit [Eubacterium ventriosum ATCC 27560] |
5.96e-53 | 100 | 91.753 | WP_005362782 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Robinsoniella] Glutaconyl-CoA decarboxylase subunit beta [Robinsoniella peoriensis] |
6.07e-53 | 100 | 92.784 | WP_027294677 |
sodium ion-translocating decarboxylase subunit beta [Anaerostipes hadrus] glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus DSM 3319] Glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus] Glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus] sodium ion-translocating decarboxylase subunit beta [Anaerostipes hadrus] |
6.33e-53 | 100 | 93.814 | WP_009203339 |
sodium ion-translocating decarboxylase subunit beta [Eubacteriaceae bacterium] Glutaconyl-CoA decarboxylase subunit beta [uncultured Eubacterium sp.] |
6.61e-53 | 100 | 93.814 | WP_147606316 |
sodium ion-translocating decarboxylase subunit beta [Blautia coccoides] oxaloacetate decarboxylase beta subunit [Blautia coccoides] sodium ion-translocating decarboxylase, beta subunit [Blautia coccoides] |
6.66e-53 | 100 | 93.814 | WP_029468781 |
sodium ion-translocating decarboxylase subunit beta [Blautia producta] Glutaconyl-CoA decarboxylase subunit beta [Blautia producta] |
7.1e-53 | 100 | 93.814 | WP_130181983 |
sodium ion-translocating decarboxylase subunit beta [Blautia schinkii] |
7.44e-53 | 100 | 93.814 | WP_044948117 |
hypothetical protein RHS_0325 [Robinsoniella sp. RHS] |
8.66e-53 | 100 | 92.784 | KLU73850 |
sodium ion-translocating decarboxylase subunit beta [Murimonas intestini] |
8.75e-53 | 100 | 91.753 | WP_148408996 |
UNVERIFIED_CONTAM: oxaloacetate decarboxylase beta subunit [Murimonas intestini] |
1.01e-52 | 100 | 91.753 | PWJ78764 |
glutaconyl-CoA decarboxylase subunit beta [Eubacterium ventriosum] |
1.02e-52 | 100 | 91.753 | PWM02569 |
sodium ion-translocating decarboxylase subunit beta [Blautia hansenii] sodium ion-translocating decarboxylase beta subunit [Blautia sp. CAG:257] |
1.08e-52 | 100 | 93.814 | WP_022067383 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Blautia] sodium ion-translocating decarboxylase subunit beta [Blautia producta] sodium ion-translocating decarboxylase subunit beta [Blautia sp. OF01-4LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF13-16] |
1.15e-52 | 100 | 92.784 | WP_033141761 |
sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] |
1.25e-52 | 100 | 91.753 | WP_118025228 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Blautia] |
1.31e-52 | 100 | 92.784 | WP_095172847 |
sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] sodium ion-translocating decarboxylase subunit beta [Eubacterium ventriosum] |
1.41e-52 | 100 | 91.753 | WP_117901132 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Blautia] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. YL58] sodium ion-translocating decarboxylase subunit beta [Blautia coccoides] |
1.43e-52 | 100 | 92.784 | WP_065541542 |
sodium ion-translocating decarboxylase subunit beta [Anaerobutyricum hallii] sodium ion-translocating decarboxylase, beta subunit [Anaerobutyricum hallii DSM 3353] glutaconyl-CoA decarboxylase subunit beta [Eubacterium sp. 38_16] sodium ion-translocating decarboxylase beta subunit [Eubacterium sp. CAG:146] sodium ion-translocating decarboxylase beta subunit [Eubacterium hallii CAG:12] Glutaconyl-CoA decarboxylase subunit beta [uncultured Eubacterium sp.] |
1.58e-52 | 100 | 90.722 | WP_005349917 |
sodium ion-translocating decarboxylase subunit beta [Anaerobutyricum hallii] sodium ion-translocating decarboxylase subunit beta [Anaerobutyricum hallii] |
1.76e-52 | 100 | 90.722 | WP_118381033 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Eubacterium] sodium ion-translocating decarboxylase subunit beta [Eubacterium sp. AF36-5BH] sodium ion-translocating decarboxylase subunit beta [Eubacterium sp. AF34-35BH] |
1.89e-52 | 100 | 91.753 | WP_117999546 |
sodium ion-translocating decarboxylase subunit beta [Anaerobutyricum soehngenii] sodium ion-translocating decarboxylase subunit beta [Anaerobutyricum soehngenii] |
1.97e-52 | 100 | 90.722 | WP_154580554 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium Oil+RF-744-WCA-WT-11] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium Oil+RF-744-WCA-WT-11] |
2.12e-52 | 100 | 91.753 | WP_154526417 |
sodium ion-translocating decarboxylase beta subunit [Eubacterium sp. CAG:192] |
2.19e-52 | 100 | 91.753 | CDB13694 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium FE2018] |
2.82e-52 | 100 | 91.753 | WP_035642342 |
sodium ion-translocating decarboxylase subunit beta [Anaerostipes hadrus] Glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus] |
3.08e-52 | 100 | 92.784 | WP_055073070 |
putative uncharacterized protein [Butyrivibrio sp. CAG:318] |
3.26e-52 | 100 | 91.753 | CDC35842 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF19-10LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF19-10LB] |
3.47e-52 | 99 | 94.792 | WP_118251464 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. OM07-19] sodium ion-translocating decarboxylase subunit beta [Blautia sp. OM07-19] sodium ion-translocating decarboxylase beta subunit [Blautia sp. CAG:237] |
4.12e-52 | 99 | 94.792 | WP_022213775 |
sodium ion-translocating decarboxylase subunit beta [Anaerotruncus sp. 1XD22-93] sodium ion-translocating decarboxylase subunit beta [Anaerotruncus sp. 1XD22-93] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] |
6.01e-52 | 100 | 91.753 | WP_120483964 |
Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] |
6.62e-52 | 100 | 91.753 | SCH81733 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
6.99e-52 | 100 | 88.660 | HAV27563 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcaceae bacterium] sodium ion-translocating decarboxylase beta subunit [Firmicutes bacterium CAG:56] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] |
7.45e-52 | 100 | 91.753 | WP_022118819 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
7.86e-52 | 100 | 91.753 | HCS84827 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. An249] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. An249] |
8.48e-52 | 100 | 91.753 | WP_087220623 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
8.96e-52 | 100 | 88.660 | HAK17731 |
sodium ion-translocating decarboxylase subunit beta [Clostridium sp. chh4-2] glutaconyl-CoA decarboxylase subunit beta [Clostridium sp. chh4-2] |
1.09e-51 | 100 | 90.722 | WP_103228772 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
1.18e-51 | 100 | 91.753 | HCI74431 |
sodium ion-translocating decarboxylase subunit beta [Eubacterium xylanophilum] |
1.41e-51 | 100 | 89.691 | WP_026835870 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM23-1] sodium ion-translocating decarboxylase, beta subunit [Ruminococcus sp. SR1/5] sodium ion-translocating decarboxylase beta subunit [Ruminococcus sp. CAG:90] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. KLE 1732] |
1.67e-51 | 100 | 91.753 | WP_015524871 |
sodium ion-translocating decarboxylase subunit beta [Blautia luti] Glutaconyl-CoA decarboxylase subunit beta [Blautia luti] |
1.78e-51 | 100 | 91.753 | WP_144093038 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium OF09-6] |
1.86e-51 | 100 | 90.722 | WP_117448989 |
sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] hypothetical protein HMPREF9473_02211 [ [Hungatella hathewayi WAL-18680] |
1.86e-51 | 100 | 90.722 | WP_006780192 |
sodium ion-translocating decarboxylase subunit beta [Hungatella effluvii] oxaloacetate decarboxylase beta subunit [Hungatella effluvii] |
1.88e-51 | 100 | 90.722 | WP_110325822 |
sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] |
2.04e-51 | 100 | 90.722 | WP_055650987 |
sodium ion-translocating decarboxylase subunit beta [Eubacterium uniforme] oxaloacetate decarboxylase, beta subunit [Eubacterium uniforme] |
2.2e-51 | 100 | 90.722 | WP_078765175 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiaceae] sodium ion-translocating decarboxylase, beta subunit [[Clostridium] hathewayi DSM 13479] [Hungatella hathewayi DSM 13479] sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] methylmalonyl-CoA decarboxylase beta subunit [Clostridium hathewayi CAG:224] |
2.2e-51 | 100 | 90.722 | WP_006774953 |
sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] sodium ion-translocating decarboxylase, beta subunit [[Clostridium] hathewayi 12489931] [Hungatella hathewayi 12489931] sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] sodium ion-translocating decarboxylase subunit beta [Hungatella hathewayi] |
2.2e-51 | 100 | 90.722 | WP_002600474 |
glutaconyl-CoA decarboxylase subunit beta [Eubacterium sp.] glutaconyl-CoA decarboxylase subunit beta [Eubacterium sp.] |
2.25e-51 | 100 | 90.722 | HAH17828 |
sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium] putative uncharacterized protein [Firmicutes bacterium CAG:424] |
2.28e-51 | 100 | 90.722 | WP_022267939 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcaceae bacterium] |
2.31e-51 | 100 | 91.753 | WP_019161472 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Blautia luti DSM 14534] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF41-9] |
2.36e-51 | 100 | 91.753 | WP_119233584 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM12-48] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF33-11BH] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. TM09-4] Glutaconyl-CoA decarboxylase subunit beta [Blautia obeum] |
2.43e-51 | 100 | 91.753 | WP_055057872 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] glutaconyl-CoA decarboxylase subunit beta [Ruminococcus sp. CAG:9-related_41_34] putative uncharacterized protein [Ruminococcus sp. CAG:9] sodium ion-translocating decarboxylase, beta subunit [Ruminococcus sp. 5_1_39BFAA] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. TM10-9AT] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF13-37] |
2.46e-51 | 100 | 91.753 | WP_008704466 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. N6H1-15] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. N6H1-15] |
2.51e-51 | 100 | 90.722 | WP_111919941 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium Oil+RF-744-WCA-WT-13] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium Oil+RF-744-WCA-WT-13] |
3.1e-51 | 100 | 90.722 | WP_154456701 |
sodium ion-translocating decarboxylase beta subunit [Roseburia sp. CAG:309] |
3.22e-51 | 100 | 90.722 | CDD34857 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
3.58e-51 | 100 | 89.691 | HAE44809 |
sodium ion-translocating decarboxylase subunit beta [Roseburia sp. MUC/MUC-530-WT-4D] |
3.9e-51 | 100 | 89.691 | WP_154428893 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] glutaconyl-CoA decarboxylase subunit beta [[Clostridium] saccharolyticum] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AM29-11AC] sodium ion-translocating decarboxylase, beta subunit [[Clostridium] cf. saccharolyticum K10] sodium ion-translocating decarboxylase beta subunit [Clostridium sp. CAG:149] |
4.35e-51 | 100 | 89.691 | WP_015574005 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Ruminococcus] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM22-13] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM07-21] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF37-6AT] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF31-16BH] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF24-32LB] |
4.44e-51 | 100 | 90.722 | WP_118247991 |
Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
4.95e-51 | 100 | 90.722 | SCH17206 |
sodium ion-translocating decarboxylase subunit beta [Roseburia sp. MUC/MUC-530-WT-4D] |
5.34e-51 | 100 | 89.691 | MST74054 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Blautia sp. SC05B48] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM41-10BH] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. OF02-6] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
5.39e-51 | 100 | 90.722 | WP_118168967 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Ruminococcus] sodium ion-translocating decarboxylase beta subunit [Ruminococcus sp. CAG:17] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. OF03-6AA] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM36-5] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM36-2AA] |
5.39e-51 | 100 | 90.722 | WP_021977785 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] |
5.42e-51 | 100 | 91.753 | WP_158440414 |
sodium ion-translocating decarboxylase subunit beta [Clostridium sp. E02] |
5.82e-51 | 100 | 89.691 | WP_124067556 |
sodium ion-translocating decarboxylase, beta subunit [Clostridium sp. M62/1] |
6.04e-51 | 100 | 89.691 | EFE13088 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] |
6.17e-51 | 100 | 91.753 | WP_158434052 |
sodium ion-translocating decarboxylase subunit beta [bacterium 0.1xD8-71] sodium ion-translocating decarboxylase subunit beta [bacterium 0.1xD8-71] |
6.82e-51 | 100 | 90.722 | WP_120410290 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM48-27BH] |
6.92e-51 | 100 | 90.722 | WP_118562819 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] hypothetical protein HMPREF9474_01760 [ [[Clostridium] symbiosum WAL-14163] sodium ion-translocating decarboxylase, beta subunit [[Clostridium] symbiosum WAL-14673] glutaconyl-CoA decarboxylase subunit beta [[Clostridium] symbiosum ATCC 14940] Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] hypothetical protein HMPREF1020_01024 [Clostridium sp. 7_3_54FAA] |
7.15e-51 | 100 | 89.691 | WP_003510703 |
glutaconyl-CoA decarboxylase subunit beta [Lachnoclostridium sp.] |
7.78e-51 | 100 | 89.691 | HBD01219 |
sodium ion-translocating decarboxylase subunit beta [Clostridium transplantifaecale] |
8.4e-51 | 100 | 89.691 | WP_125140134 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
8.78e-51 | 100 | 88.660 | HAK57975 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_157 In bact CP040530.1
Seq (len = 31 ):
MPCQQLYFLDKKGVGGCRIYGYSGNLYLCGQ
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|304491|-1|5313951-5314086
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.3545777306509077
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_158 In anaero CP036345.1
Seq (len = 141 ):
MPINWCPSCKTGLANEEVVNGKCERCGADVTKKNLRQWMLKITENTDRLLGDLDKLDWPEKFKKMQAEWIGKNHGAEVDFKLEDRDEAITVYTTRPDTLHAATFMVLAPQHKLAAELATDETYHCPKKTMVYTPSLIWKFI
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|65851|1|1616605-1617286
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
4.254664918040415
unique PSMS
3
unique PSMS
3
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_159 In anaero CP036345.1
Seq (len = 112 ):
MPALRQDKSASTADIPCDRPLSEKAHKSGLLHTLSDPVSLNKVLSNINNSHSKKDLTEPHSYSAQVLQSLSRLLPLRREQYDSAGLRESSVSLRMPLPPSVRSDSFPFPQTP
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|242294|-1|867841-868258
Transkriptom
89.0% of gene length expressed over median expression of contig.
ŝ
1.9097419470686834
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein Btheta7330_04557 [Bacteroides thetaiotaomicron] hypothetical protein C799_04671 [Bacteroides thetaiotaomicron dnLKV9] uncharacterized protein BN644_01775 [Bacteroides thetaiotaomicron CAG:40] hypothetical protein BSIG_5604 [Bacteroides thetaiotaomicron] Uncharacterised protein [Bacteroides thetaiotaomicron] |
6.89e-12 | 100 | 100.000 | ALJ44075 |
hypothetical protein C801_00561 [Bacteroides uniformis dnLKV2] |
3.28e-07 | 100 | 80.556 | EOS10620 |
hypothetical protein C802_01749 [Bacteroides sartorii] |
1.09e-06 | 100 | 80.556 | EOS13902 |
hypothetical protein HMPREF1061_04455 [Bacteroides caccae CL03T12C61] hypothetical protein C800_03335 [Bacteroides vulgatus dnLKV7] Uncharacterised protein [Bacteroides uniformis] |
6.37e-06 | 100 | 77.778 | EIY16197 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_160 In lacto CP039121.1
Seq (len = 26 ):
DDAGWALAQIDVGCVPAIVTQPRRSA
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|52605|1|951024-951102
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.4302750507738407
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_161 In lacto CP039121.1
Seq (len = 26 ):
DDAGWALAQIDVGCVPAIVTQPRRSA
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|43846|1|785901-785979
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.4302750507738407
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
leuS protein [Anaerostipes caccae]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
putative leucine--tRNA ligase [Anaerostipes caccae DSM 14662] |
4.91e-101 | 100 | 100.000 | EDR97699 |
leuS protein [Anaerostipes caccae] leuS protein [Anaerostipes sp. CAG:276] |
7.18e-101 | 100 | 100.000 | EFV23017 |
leucine--tRNA ligase [Anaerostipes caccae] |
2.62e-74 | 96 | 87.500 | WP_039946539 |
leucine--tRNA ligase [Anaerostipes caccae] |
2.85e-74 | 96 | 87.500 | WP_156340482 |
MULTISPECIES: leucine--tRNA ligase [Anaerostipes] leucine--tRNA ligase [Anaerostipes sp. AF04-45] |
2.91e-74 | 96 | 87.500 | WP_118475448 |
leucine--tRNA ligase [Anaerostipes caccae] |
3.33e-74 | 96 | 87.500 | WP_129701699 |
leucine--tRNA ligase [Anaerostipes caccae DSM 14662] |
3.41e-74 | 96 | 87.500 | EDR97539 |
leucine--tRNA ligase [Anaerostipes caccae] leucyl-tRNA synthetase [Anaerostipes caccae] leucine--tRNA ligase [Anaerostipes sp. CAG:276] |
1.14e-73 | 96 | 86.765 | WP_009289428 |
leucine--tRNA ligase [Anaerostipes sp. BG01] |
1.83e-72 | 96 | 85.294 | WP_024727152 |
leucine--tRNA ligase [Hungatella hathewayi] |
1.89e-72 | 96 | 85.294 | RGC82753 |
leucine--tRNA ligase [Lachnospiraceae bacterium] |
1.93e-72 | 96 | 85.294 | WP_148460205 |
leucine--tRNA ligase [Anaerostipes hadrus] |
2.08e-68 | 96 | 79.412 | HCL36099 |
leucine--tRNA ligase [Anaerostipes rhamnosivorans] Leucyl-tRNA synthetase [Anaerostipes rhamnosivorans] |
3.97e-68 | 87 | 88.525 | WP_137328980 |
leucine--tRNA ligase [Firmicutes bacterium CAG:270] |
2.33e-67 | 96 | 80.147 | CDD70382 |
leucine--tRNA ligase [Eubacteriaceae bacterium] Leucine--tRNA ligase [uncultured Eubacterium sp.] |
2.43e-67 | 96 | 80.147 | WP_147605114 |
leucine--tRNA ligase [Firmicutes bacterium AF12-30] leucine--tRNA ligase [Firmicutes bacterium AF12-30] |
2.54e-67 | 96 | 80.147 | WP_117944647 |
leucine--tRNA ligase [Anaerostipes hadrus] Leucine--tRNA ligase [Anaerostipes hadrus] |
2.59e-67 | 96 | 80.147 | WP_055196843 |
leucyl-tRNA synthetase [Anaerostipes hadrus] |
7.76e-67 | 96 | 79.412 | CBL38063 |
leucine--tRNA ligase [Lachnospiraceae bacterium 5_1_63FAA] leucyl-tRNA synthetase [Lachnospiraceae bacterium 5_1_63FAA] |
7.76e-67 | 96 | 79.412 | WP_009263908 |
leucine--tRNA ligase [Lachnospiraceae bacterium TF10-8AT] leucine--tRNA ligase [Lachnospiraceae bacterium TF10-8AT] |
8.34e-67 | 96 | 79.412 | WP_118627764 |
leucine--tRNA ligase [Anaerostipes hadrus] leucine--tRNA ligase [Anaerostipes hadrus DSM 3319] leucine--tRNA ligase [Clostridiales bacterium Nov_37_41] leucine--tRNA ligase [Lachnospiraceae bacterium CAG:25] leucine--tRNA ligase [Anaerostipes hadrus] leucine--tRNA ligase [Lachnospiraceae bacterium AM23-7LB] |
8.79e-67 | 96 | 79.412 | WP_009204519 |
leucine--tRNA ligase [Anaerostipes hadrus] |
8.88e-67 | 96 | 79.412 | WP_044923325 |
leucine--tRNA ligase [Anaerostipes hadrus] leucine--tRNA ligase [Anaerostipes hadrus] |
9.06e-67 | 96 | 79.412 | WP_149883290 |
leucine--tRNA ligase [Anaerostipes hadrus] |
1.01e-66 | 96 | 79.412 | WP_156722444 |
leucine--tRNA ligase [Clostridium sp. SS2/1] leucine--tRNA ligase [Clostridium sp. SS2/1] |
3.9e-66 | 96 | 78.676 | WP_008391505 |
leucine--tRNA ligase [Ruminococcus sp. AM16-34] leucine--tRNA ligase [Ruminococcus sp. AM16-34] |
5.62e-66 | 96 | 78.676 | WP_117497284 |
leucine--tRNA ligase [[Ruminococcus] torques] Leucine--tRNA ligase [[Ruminococcus] torques] |
5.86e-66 | 96 | 78.676 | WP_144366990 |
leucine--tRNA ligase [[Ruminococcus] torques] Leucine--tRNA ligase [[Ruminococcus] torques] |
7.27e-66 | 96 | 78.676 | WP_055148214 |
leucine--tRNA ligase [Ruminococcus sp. AF12-5] leucine--tRNA ligase [Ruminococcus sp. AF12-5] |
7.43e-66 | 96 | 78.676 | WP_117915485 |
MULTISPECIES: leucine--tRNA ligase [Clostridiales] leucine--tRNA ligase [Ruminococcus faecis] Leucine--tRNA ligase [[Ruminococcus] torques] Leucine--tRNA ligase [[Ruminococcus] torques] |
7.43e-66 | 96 | 78.676 | WP_055163098 |
MULTISPECIES: leucine--tRNA ligase [unclassified Ruminococcus] leucine--tRNA ligase [Ruminococcus sp. AF25-13] leucine--tRNA ligase [Ruminococcus sp. AF24-16] |
2.2e-65 | 96 | 77.941 | WP_117875128 |
MULTISPECIES: leucine--tRNA ligase [Clostridiales] leucine--tRNA ligase [Ruminococcus sp. AM27-11LB] leucine--tRNA ligase [Ruminococcus sp. AM27-27] |
2.29e-65 | 96 | 77.941 | WP_117890089 |
MULTISPECIES: leucine--tRNA ligase [unclassified Ruminococcus] leucine--tRNA ligase [Ruminococcus sp. TF10-6] leucine--tRNA ligase [Ruminococcus sp. AM09-18-1] leucine--tRNA ligase [Ruminococcus sp. AF32-2AC] leucine--tRNA ligase [Ruminococcus sp. AF31-14BH] leucine--tRNA ligase [Ruminococcus sp. AM57-5] |
2.36e-65 | 96 | 77.941 | WP_117569403 |
leucine--tRNA ligase [Ruminococcus sp. AM22-14LB] leucine--tRNA ligase [Ruminococcus sp. AM22-14LB] |
2.51e-65 | 96 | 77.941 | WP_117539357 |
MULTISPECIES: leucine--tRNA ligase [unclassified Ruminococcus] leucine--tRNA ligase [Ruminococcus sp. OM08-13AT] leucine--tRNA ligase [Ruminococcus sp. OF05-2BH] |
3.09e-65 | 96 | 77.941 | WP_118173975 |
leucine--tRNA ligase [[Ruminococcus] torques] leucyl-tRNA synthetase [[Ruminococcus] torques L2-14] leucine--tRNA ligase [Ruminococcus sp. CAG:55] Leucine--tRNA ligase [[Ruminococcus] torques] Leucine--tRNA ligase [[Ruminococcus] torques] |
3.53e-65 | 96 | 77.941 | WP_015529674 |
leucine--tRNA ligase [Acetitomaculum ruminis] leucyl-tRNA synthetase [Acetitomaculum ruminis DSM 5522] |
4.81e-65 | 87 | 84.426 | WP_092869970 |
leucine--tRNA ligase [Anaerostipes sp. 494a] leucine--tRNA ligase [Anaerostipes sp. 494a] |
6.97e-65 | 96 | 78.676 | WP_075758915 |
MULTISPECIES: leucine--tRNA ligase [unclassified Lachnospiraceae] leucine-tRNA ligase [Lachnospiraceae bacterium 2_1_46FAA] |
7.78e-65 | 93 | 78.626 | WP_009460669 |
leucine--tRNA ligase [Coprococcus sp. AF21-14LB] leucine--tRNA ligase [Coprococcus sp. AF21-14LB] |
7.86e-65 | 87 | 83.607 | WP_118347291 |
leucine--tRNA ligase [Ruminococcus faecis] |
1e-64 | 96 | 77.206 | WP_054753899 |
leucine--tRNA ligase [Anaerosacchriphilus polymeriproducens] leucine--tRNA ligase [Anaerosacchriphilus polymeriproducens] |
1.31e-64 | 96 | 75.000 | WP_115482339 |
leucine--tRNA ligase [[Clostridium] glycyrrhizinilyticum] |
1.82e-64 | 96 | 76.471 | WP_054703499 |
leucine--tRNA ligase [Dorea sp. CAG:317] |
2.08e-64 | 96 | 77.206 | CDD07248 |
leucine--tRNA ligase [Blautia hansenii] leucine--tRNA ligase [Lachnospiraceae bacterium CAG:364] |
2.08e-64 | 96 | 77.206 | WP_022239716 |
leucyl-tRNA synthetase [Lachnospiraceae bacterium 1_4_56FAA] |
2.39e-64 | 96 | 76.471 | EGN31843 |
leucine--tRNA ligase [Eubacterium ruminantium] leucyl-tRNA synthetase [Eubacterium ruminantium] leucyl-tRNA synthetase [Eubacterium ruminantium] leucyl-tRNA synthetase [Eubacterium ruminantium] |
2.75e-64 | 87 | 85.246 | WP_078785795 |
leucine--tRNA ligase [Ruminococcus lactaris] leucine-tRNA ligase [Ruminococcus lactaris CC59_002D] leucine--tRNA ligase [Ruminococcus lactaris] leucine--tRNA ligase [Ruminococcus lactaris] |
2.78e-64 | 96 | 77.206 | WP_023922196 |
leucine--tRNA ligase [Ruminococcus lactaris] leucine--tRNA ligase [Ruminococcus lactaris] |
2.81e-64 | 96 | 77.206 | WP_044940554 |
leucine--tRNA ligase [[Ruminococcus] gnavus] |
2.83e-64 | 87 | 82.787 | WP_156729082 |
MULTISPECIES: leucine--tRNA ligase [Lachnospiraceae] leucine--tRNA ligase [Tyzzerella nexilis DSM 1787] leucine--tRNA ligase [Clostridium nexile CAG:348] leucine--tRNA ligase [Clostridium sp.] leucine--tRNA ligase [Tyzzerella nexilis] leucine--tRNA ligase [Tyzzerella nexilis] |
2.85e-64 | 96 | 76.471 | WP_004614008 |
leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] |
2.95e-64 | 96 | 75.735 | WP_101870011 |
leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] |
2.98e-64 | 96 | 75.735 | WP_101879778 |
leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] |
3.08e-64 | 96 | 75.735 | WP_118444883 |
leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] |
3.14e-64 | 87 | 82.787 | WP_101883843 |
leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] |
3.18e-64 | 96 | 75.735 | WP_117993637 |
leucine--tRNA ligase [[Ruminococcus] gnavus] |
3.18e-64 | 96 | 75.735 | WP_064786380 |
leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus ATCC 29149] leucine-tRNA ligase [[Ruminococcus] gnavus CC55_001C] Leucine--tRNA ligase [uncultured Ruminococcus sp.] leucine--tRNA ligase [Ruminococcus sp.] leucyl-tRNA synthetase [Lachnospiraceae bacterium 2_1_58FAA] |
3.24e-64 | 87 | 82.787 | WP_004844262 |
leucine--tRNA ligase [Blautia hansenii] leucine--tRNA ligase [Blautia hansenii DSM 20583] leucine--tRNA ligase [Blautia hansenii DSM 20583] leucyl-tRNA synthetase [Lachnospiraceae bacterium 6_1_63FAA] |
3.83e-64 | 96 | 76.471 | WP_004222367 |
leucyl-tRNA synthetase [Dorea formicigenerans 4_6_53AFAA] |
3.9e-64 | 96 | 76.471 | EGX74774 |
leucine--tRNA ligase [Ruminococcus lactaris ATCC 29176] |
3.9e-64 | 96 | 77.206 | EDY33371 |
leucine--tRNA ligase [Blautia sp. Marseille-P3201T] |
4.16e-64 | 96 | 76.471 | WP_072449469 |
MULTISPECIES: leucine--tRNA ligase [unclassified Lachnospiraceae] leucine--tRNA ligase [Lachnospiraceae bacterium AM25-22] leucine--tRNA ligase [Lachnospiraceae bacterium AM25-11LB] leucine--tRNA ligase [Lachnospiraceae bacterium AM25-40] leucine--tRNA ligase [Lachnospiraceae bacterium AM25-39] |
4.16e-64 | 96 | 76.471 | WP_117467970 |
MULTISPECIES: leucine--tRNA ligase [unclassified Lachnospiraceae] leucine--tRNA ligase [Lachnospiraceae bacterium AM23-2LB] leucine--tRNA ligase [Lachnospiraceae bacterium AM40-2BH] |
4.7e-64 | 96 | 76.471 | WP_117550380 |
leucine--tRNA ligase [Hespellia stercorisuis] leucyl-tRNA synthetase [Hespellia stercorisuis DSM 15480] |
4.73e-64 | 92 | 79.231 | WP_073110615 |
leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus CAG:126] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] leucine--tRNA ligase [[Ruminococcus] gnavus] |
4.79e-64 | 87 | 82.787 | WP_022036834 |
leucine--tRNA ligase [[Ruminococcus] gnavus] |
5e-64 | 87 | 82.787 | WP_024854437 |
leucine--tRNA ligase [Roseburia sp. CAG:471] |
5.11e-64 | 96 | 75.735 | CDE01501 |
leucine--tRNA ligase [Merdimonas faecis] |
6.32e-64 | 96 | 76.471 | WP_070088233 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
6.46e-64 | 96 | 76.471 | WP_119196556 |
MULTISPECIES: leucine--tRNA ligase [unclassified Lachnospiraceae] leucine--tRNA ligase [Lachnospiraceae bacterium OM02-31] leucine--tRNA ligase [Lachnospiraceae bacterium OM02-3] |
7.29e-64 | 96 | 77.206 | WP_120094581 |
leucine--tRNA ligase [Lachnospiraceae bacterium CAG:215] |
8.19e-64 | 96 | 75.735 | CDB00826 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
8.53e-64 | 96 | 76.471 | WP_117649368 |
leucine--tRNA ligase [Clostridium sp. Marseille-P3244] |
8.62e-64 | 96 | 76.471 | WP_072525192 |
leucine--tRNA ligase [Roseburia sp. 1XD42-69] leucine--tRNA ligase [Roseburia sp. 1XD42-69] |
8.64e-64 | 96 | 76.471 | WP_120406161 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
8.7e-64 | 96 | 76.471 | WP_118145288 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
8.7e-64 | 96 | 76.471 | WP_117494171 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
9.26e-64 | 96 | 76.471 | WP_118236783 |
Leucine--tRNA ligase [uncultured Dorea sp.] |
9.26e-64 | 96 | 76.471 | SCH52945 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
9.45e-64 | 96 | 76.471 | WP_118363891 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
9.45e-64 | 96 | 76.471 | WP_117606515 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
9.85e-64 | 96 | 76.471 | WP_119210188 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
1.01e-63 | 96 | 76.471 | WP_118000988 |
leucine--tRNA ligase [Dorea formicigenerans ATCC 27755] |
1.06e-63 | 96 | 76.471 | EDR45665 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
1.08e-63 | 96 | 76.471 | WP_118396969 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
1.09e-63 | 96 | 76.471 | WP_117613166 |
leucine--tRNA ligase [Dorea sp. AGR2135] |
1.1e-63 | 96 | 76.471 | WP_029731346 |
leucine--tRNA ligase [Dorea formicigenerans] leucine--tRNA ligase [Dorea formicigenerans] |
1.13e-63 | 96 | 76.471 | WP_117659950 |
leucine--tRNA ligase [Firmicutes bacterium CAG:212] |
1.13e-63 | 96 | 76.471 | CDA15379 |
leucine--tRNA ligase [Firmicutes bacterium AM43-11BH] leucine--tRNA ligase [Firmicutes bacterium AM43-11BH] |
1.14e-63 | 96 | 76.471 | WP_118723592 |
Leucine--tRNA ligase [uncultured Clostridium sp.] |
1.22e-63 | 96 | 76.471 | SCG94729 |
leucine--tRNA ligase [Roseburia sp.] |
1.31e-63 | 96 | 76.471 | HCJ76485 |
MULTISPECIES: leucine--tRNA ligase [unclassified Roseburia] leucine--tRNA ligase [Roseburia sp. AF42-8] leucine--tRNA ligase [Roseburia sp. AF34-16] leucine--tRNA ligase [Roseburia sp. AF22-8AC] leucine--tRNA ligase [Roseburia sp. AF22-2LB] leucine--tRNA ligase [Roseburia sp. AF02-12] |
1.32e-63 | 96 | 76.471 | WP_117698990 |
MULTISPECIES: leucine--tRNA ligase [unclassified Roseburia] leucine--tRNA ligase [Roseburia sp. OM04-10BH] leucine--tRNA ligase [Roseburia sp. OM04-15AA] leucine--tRNA ligase [Roseburia sp. OM04-10AA] |
1.32e-63 | 96 | 76.471 | WP_117946981 |
leucine--tRNA ligase [Roseburia sp.] |
1.32e-63 | 96 | 76.471 | HAX12454 |
leucine--tRNA ligase [Roseburia sp. CAG:45] Leucine--tRNA ligase [uncultured Roseburia sp.] |
1.32e-63 | 96 | 76.471 | CDC10447 |
leucine--tRNA ligase [Roseburia sp. AF20-18LB] leucine--tRNA ligase [Roseburia sp. AF20-18LB] |
1.38e-63 | 96 | 76.471 | WP_118172551 |
leucine--tRNA ligase [Eisenbergiella tayi] Leucine--tRNA ligase [Eisenbergiella tayi] |
1.56e-63 | 96 | 76.471 | WP_069152376 |
MULTISPECIES: leucine--tRNA ligase [Clostridiales] leucine--tRNA ligase [Ruminococcus sp. B05] leucine--tRNA ligase [Mediterraneibacter sp. gm002] |
1.6e-63 | 96 | 76.471 | WP_121055135 |
MULTISPECIES: leucine--tRNA ligase [unclassified Lachnospiraceae] leucine-tRNA ligase [Lachnospiraceae bacterium 3_1_57FAA_CT1] |
1.7e-63 | 96 | 76.471 | WP_009252858 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_162 In lacto CP039121.1
Seq (len = 26 ):
DDAGYALAQIDVGCVPAIVTQPRRSE
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|298563|-1|770530-770608
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.4302750507738407
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_163 In lacto CP039121.1
Seq (len = 26 ):
DDAGYALAQIDVGCVPAIVTQPRRSE
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|237980|-1|1978567-1978645
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.4302750507738407
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_164 In lacto CP039121.1
Seq (len = 19 ):
IVNHLSGALPMNRLIAKPH
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|236794|-1|2001828-2001888
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.35261702988538
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_165 In lacto CP039121.1
Seq (len = 26 ):
DDAGYALAQIDVGCVPAIVTQPRRSE
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|227128|-1|2192193-2192271
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.4302750507738407
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_166 In lacto CP039121.1
Seq (len = 40 ):
MFSLLIPAAGQVPLVKIELGIEVYRKGLSGKSTSTLLMTD
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|214299|-1|2428276-2428510
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7391339283862317
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_167 In lacto CP039121.1
Seq (len = 26 ):
DDAGYALAQIDVGCVPAIVTQPRRSE
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|18570|1|329268-329346
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.4302750507738407
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_168 In lacto CP039121.1
Seq (len = 22 ):
NSPLSSRSFLIIQFPPQLLIKS
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|151429|1|2874572-2874638
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.8326826652518238
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_169 In lacto CP039121.1
Seq (len = 26 ):
DDAGYALAQIDVGCVPAIVTQPRRSA
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|113064|1|2114991-2115069
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.4302750507738407
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_170 In ery NZ_CP036346.1
Seq (len = 18 ):
TVPSSPLSPLSPLIKLHV
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|402914|-1|463790-463844
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7887014327169517
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_171 In clostri CP040626.1
Seq (len = 35 ):
HLTSEVLLIKYWQFLFFFYLLLMLLIYFSNYQILS
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|197052|1|2830894-2830999
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.938924676370208
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_172 In blautia CP039126.1
Seq (len = 7 ):
LSMSGMW
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|83418|1|2160296-2160380
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.713693261156725
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_173 In blautia CP039126.1
Seq (len = 55 ):
LYRKAGSKGYQDSPRNSPARFFRYKDNGDHVSERRSFPRKTPAVLLKKLFFAHWI
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|388441|-1|1793966-1794146
Transkriptom
4.0% of gene length expressed over median expression of contig.
ŝ
2.8763661050800438
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) > 3}
Candidate nov_psm6_174 In blautia CP039126.1
Seq (len = 49 ):
MINYEEELKKFQPCLDVDDAEGNIYKQDLTDVIDILKEMLKETNGTAKN
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|264770|-1|5172131-5172278
Transkriptom
52.0% of gene length expressed over median expression of contig.
ŝ
3.31695296176115
unique PSMS
4
unique PSMS
4
Genomic Context
Candidate has annotation on SAME strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_175 In blautia CP039126.1
Seq (len = 19 ):
MPASNLPPPPLHPSMSMWG
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|227413|-1|6115037-6115100
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7070059599325607
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 10 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_176 In blautia CP039126.1
Seq (len = 99 ):
IRSGKTGRHRRSRELCGCLRPGDRCGSERSCSEQHCFRTCHAQSEETVCTDIKRSRQDGCHDGRRCQRCAGTEGCGLQYCHGLRQRRGSPGVPACTAGI
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|138285|1|3696043-3696352
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.1532506481791533
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_177 In bifi AE014295.3
Seq (len = 77 ):
MLLAEGRQLTLVEFADGYAADSHAAARRFFHAGQLVEQRGFAGAGFAENAADLALRDTEIDTVKRHHRLILDGVFLA
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|21287|1|980301-980895
Transkriptom
98.0% of gene length expressed over median expression of contig.
ŝ
2.151810883008601
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_178 In bact CP040530.1
Seq (len = 35 ):
WKETPPVSTCQQRRTVVASGCRENITVIQGVVHTS
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|49071|1|1249019-1249124
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.644612342013426
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_179 In bact CP040530.1
Seq (len = 233 ):
MWGNRLALVNFKACNTVTFHPVDGDMYFNSWDKGQFFKVEKQQIQEIFDGTRTTPADKEVLFQMDNGWEYNIRIHPTGNYAYIVSINKHYIQRTNYDWASKRFVTPFIVAGTAERAAYVDGIGTSARFNTPYQGVFVKNPEYAGQEDEYDFILCDKMGQCIRKITPQGKVSTFAGRGSASLNGNPWGYVDGDLRQEARFDRPKGIAYDEATDTYYIGDGSNRRIRKIAYEGEE
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|447790|-1|1795728-1796601
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
4.270233341050123
unique PSMS
5
unique PSMS
5
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) > 3}
Candidate nov_psm6_180 In bact CP040530.1
Seq (len = 50 ):
MARPIKETPILFGEDARRFEERMKEKRRETSEQRAKRLKDYELAMKIFKK
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|264844|-1|6236441-6236597
Transkriptom
86.0% of gene length expressed over median expression of contig.
ŝ
2.7955905841564856
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_181 In bact CP040530.1
Seq (len = 34 ):
FKAEEKAGTGNSSFIASATRFFHPGSKDLISSRK
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|218674|1|5098320-5098422
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6784706092743935
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 35 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_182 In anaero CP036345.1
Seq (len = 57 ):
MRREQTMYSVEEFACSPEVLEASEDLIRAAFSYAGLEEATEKKAKKIIREFKNKEVH
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|29547|1|705473-705740
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
4.555851069209849
unique PSMS
3
unique PSMS
3
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
IPT/TIG domain./NHL repeat [Bacteroides thetaiotaomicron]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
IPT/TIG domain protein [Bacteroides thetaiotaomicron] hypothetical protein C799_03898 [Bacteroides thetaiotaomicron dnLKV9] IPT/TIG domain-containing protein [Bacteroides sp. AR20] hypothetical protein BSIG_5402 [Bacteroides thetaiotaomicron] NHL repeat protein [Bacteroides thetaiotaomicron] |
7.89e-171 | 100 | 100.000 | ALJ44330 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein BT_3492 [Bacteroides thetaiotaomicron VPI-5482] conserved hypothetical protein, with a conserved domain [Bacteroides thetaiotaomicron VPI-5482] hypothetical protein GAO47_00470 [Bacteroides thetaiotaomicron] hypothetical protein GAO35_26810 [Bacteroides thetaiotaomicron] hypothetical protein GAO40_01890 [Bacteroides thetaiotaomicron] hypothetical protein GAO48_01715 [Bacteroides thetaiotaomicron] |
8.07e-171 | 100 | 100.000 | WP_011108849 |
hypothetical protein [Bacteroides thetaiotaomicron] hypothetical protein DWW05_06125 [Bacteroides thetaiotaomicron] hypothetical protein DW697_15040 [Bacteroides thetaiotaomicron] |
9.24e-170 | 100 | 99.571 | WP_117977603 |
hypothetical protein [Bacteroides thetaiotaomicron] |
1.31e-160 | 100 | 93.562 | WP_081030574 |
IPT/TIG domain./NHL repeat [Bacteroides thetaiotaomicron] |
3.41e-160 | 100 | 93.562 | CUQ34779 |
hypothetical protein [Bacteroides faecis] hypothetical protein F2Z43_20895 [Bacteroides faecis] hypothetical protein F2Z11_22310 [Bacteroides faecis] hypothetical protein F2Z35_20435 [Bacteroides faecis] |
8.53e-158 | 100 | 91.845 | WP_138335593 |
IPT/TIG domain./NHL repeat [Bacteroides thetaiotaomicron] |
8.48e-153 | 89 | 100.000 | SQC92855 |
hypothetical protein [Bacteroides caecimuris] hypothetical protein D7W50_00010 [Bacteroides caecimuris] |
3.87e-124 | 99 | 71.610 | WP_120465826 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein E5353_03115 [Bacteroides caecimuri] |
4.55e-124 | 99 | 71.610 | WP_065540527 |
hypothetical protein GAO02_26500, partial [Bacteroides thetaiotaomicron] |
5.18e-107 | 65 | 100.000 | KAB4389590 |
IPT/TIG domain-containing protein [Mangrovibacterium diazotrophicum] |
1.78e-87 | 96 | 55.556 | RKD91344 |
hypothetical protein [Mangrovibacterium diazotrophicum] |
2.11e-87 | 96 | 55.556 | WP_120274205 |
hypothetical protein [Pedobacter sp. FJ4-8] hypothetical protein DDR33_01645 [Pedobacter sp. FJ4-8] |
4.29e-87 | 98 | 56.897 | WP_109414010 |
MULTISPECIES: hypothetical protein [unclassified Flavobacterium] hypothetical protein FNW17_07220 [Flavobacterium sp. LB3P56] hypothetical protein FNW25_06105 [Flavobacterium sp. LB3P62] |
3.01e-85 | 99 | 54.936 | WP_143390238 |
hypothetical protein [Bacteroides thetaiotaomicron] hypothetical protein BT_3482 [Bacteroides thetaiotaomicron VPI-5482] conserved hypothetical protein containing NHL repeat [Bacteroides thetaiotaomicron VPI-5482] IPT/TIG domain protein [Bacteroides thetaiotaomicron] hypothetical protein BSIG_5391 [Bacteroides thetaiotaomicron] hypothetical protein FIB20_09765 [Bacteroides thetaiotaomicron] hypothetical protein FIA61_24615 [Bacteroides thetaiotaomicron] |
1.63e-84 | 98 | 55.556 | WP_008767674 |
hypothetical protein [Bacteroides thetaiotaomicron] NHL repeat-containing protein [Bacteroides thetaiotaomicron] |
2.14e-84 | 98 | 55.556 | WP_103878255 |
hypothetical protein GAN75_19335 [Bacteroides thetaiotaomicron] |
2.74e-84 | 98 | 55.556 | KAB4453004 |
hypothetical protein [Sphingobacterium alkalisoli] hypothetical protein FAZ19_02865 [Sphingobacterium alkalisoli] |
7.07e-84 | 98 | 54.978 | WP_136819082 |
hypothetical protein [Sphingobacteriaceae bacterium DW12] |
9.26e-84 | 98 | 56.466 | WP_033564617 |
hypothetical protein B7Y83_01415 [Flavobacteriales bacterium 32-34-25] |
4.18e-83 | 99 | 55.556 | OYX86415 |
hypothetical protein [Sphingobacterium sp. B29] hypothetical protein BV902_01630 [Sphingobacterium sp. B29] |
6.71e-83 | 98 | 56.897 | WP_075990487 |
hypothetical protein [Sphingobacterium sp. 5.0403-2] |
6.73e-83 | 97 | 55.947 | WP_149914484 |
hypothetical protein [Sunxiuqinia dokdonensis] hypothetical protein NC99_19240 [Sunxiuqinia dokdonensis] |
7.29e-83 | 97 | 52.655 | WP_157624724 |
hypothetical protein [Bacteroidaceae bacterium HV4-6-C5C] hypothetical protein FQ707_09850 [Bacteroidaceae bacterium HV4-6-C5C] |
9.12e-83 | 96 | 53.363 | WP_146267375 |
NHL repeat-containing protein [Sphingobacterium faecium PCAi_F2.5] |
9.47e-83 | 98 | 54.545 | SJN46253 |
hypothetical protein [Sphingobacterium faecium] hypothetical protein [Sphingobacterium faecium] IPT/TIG domain-containing protein [Sphingobacterium faecium] hypothetical protein SF1_12050 [Sphingobacterium faecium NBRC 15299] |
1.29e-82 | 98 | 54.545 | WP_108158914 |
hypothetical protein [Sphingobacterium sp. PM2-P1-29] conserved hypothetical protein [Sphingobacterium sp. PM2-P1-29] |
1.75e-82 | 98 | 54.113 | WP_052627603 |
hypothetical protein [Sphingobacterium multivorum] IPT/TIG domain [Sphingobacterium multivorum] |
1.87e-82 | 98 | 56.466 | WP_112375196 |
hypothetical protein [Sphingobacterium sp.] hypothetical protein [Sphingobacterium sp.] |
3.39e-82 | 98 | 56.466 | HAU53198 |
hypothetical protein [Dysgonomonas gadei] |
3.56e-82 | 97 | 55.652 | WP_044216887 |
hypothetical protein [Sphingobacterium multivorum] IPT/TIG domain [Sphingobacterium multivorum] hypothetical protein [Sphingobacterium sp.] |
3.78e-82 | 98 | 56.466 | WP_115046000 |
hypothetical protein [Sphingobacterium sp. HMSC13C05] hypothetical protein HMPREF3127_05940 [Sphingobacterium sp. HMSC13C05] |
4.12e-82 | 98 | 56.466 | WP_070562418 |
hypothetical protein [Sphingobacterium sp. JUb78] |
5.14e-82 | 98 | 53.680 | WP_132771026 |
IPT/TIG domain-containing protein [Sphingobacterium sp. JUb78] |
5.78e-82 | 98 | 53.680 | TCR11612 |
hypothetical protein HMPREF9455_04011 [Dysgonomonas gadei ATCC BAA-286] |
6.21e-82 | 97 | 55.652 | EGJ99597 |
hypothetical protein [Sphingobacterium sp. JUb20] |
1e-81 | 98 | 53.247 | WP_132842144 |
IPT/TIG domain-containing protein [Sphingobacterium sp. JUb20] |
1.37e-81 | 98 | 53.247 | TCR08159 |
conserved hypothetical protein [Sphingobacterium sp. 8BC] hypothetical protein [Sphingobacterium sp.] |
1.44e-81 | 98 | 56.034 | VXC30700 |
hypothetical protein [Sphingobacterium sp. IITKGP-BTPF85] hypothetical protein L950_0222500 [Sphingobacterium sp. IITKGP-BTPF85] |
2.26e-81 | 98 | 53.247 | WP_021191064 |
hypothetical protein [Sphingobacterium sp.] |
2.86e-81 | 98 | 54.894 | HCU43579 |
hypothetical protein [Pedobacter tournemirensis] hypothetical protein F1649_03445 [Pedobacter tournemirensis] |
5.84e-81 | 98 | 54.113 | WP_141816470 |
IPT/TIG domain-containing protein [Pedobacter tournemirensis] |
9.79e-81 | 98 | 54.113 | TQM48738 |
NHL repeat protein,IPT/TIG domain-containing protein [Sphingobacterium sp. ML3W] |
9.97e-81 | 98 | 52.814 | AIM37938 |
hypothetical protein [Sphingobacterium sp. ML3W] |
1.57e-80 | 98 | 52.814 | WP_051959958 |
hypothetical protein [Pedobacter tournemirensis] hypothetical protein EKH83_03885 [Pedobacter tournemirensis] |
2.14e-80 | 98 | 53.680 | WP_128768233 |
hypothetical protein [Bacteroides faecichinchillae] hypothetical protein E5981_16865 [Bacteroides faecichinchillae] |
5.87e-80 | 98 | 52.991 | WP_136498584 |
hypothetical protein [Niabella aurantiaca] |
8.32e-80 | 96 | 52.000 | WP_018629298 |
conserved hypothetical protein [Zunongwangia profunda SM-A87] |
1.94e-79 | 98 | 54.936 | ADF50581 |
hypothetical protein [Zunongwangia profunda] hypothetical protein [Zunongwangia sp.] |
2.59e-79 | 98 | 54.936 | WP_049771402 |
hypothetical protein [Leeuwenhoekiella polynyae] |
5.75e-79 | 98 | 53.879 | WP_128765558 |
NHL repeat-containing protein [Leeuwenhoekiella polynyae] |
7.57e-79 | 98 | 53.879 | RXG21745 |
hypothetical protein [Zunongwangia sp.] |
1.15e-78 | 98 | 54.506 | MAO37620 |
hypothetical protein [Flavobacteriaceae bacterium] |
1.56e-78 | 98 | 54.506 | MAC63869 |
hypothetical protein [Leeuwenhoekiella marinoflava] |
1.97e-78 | 98 | 51.948 | WP_128759392 |
IPT/TIG domain-containing protein [Leeuwenhoekiella marinoflava] IPT/TIG domain-containing protein [Leeuwenhoekiella marinoflava DSM 3653] |
2.5e-78 | 98 | 51.948 | RXG25900 |
NHL repeat-containing protein [Arachidicoccus rhizosphaerae] |
9.73e-78 | 96 | 50.893 | SDZ86305 |
hypothetical protein [Cytophagaceae bacterium] |
1.05e-77 | 98 | 51.082 | MAZ28309 |
hypothetical protein [Arcticibacter eurypsychrophilus] |
1.39e-77 | 98 | 52.814 | WP_069659595 |
hypothetical protein [Arachidicoccus rhizosphaerae] |
1.39e-77 | 96 | 50.893 | WP_091393689 |
hypothetical protein [Sphingobacterium sp. Ag1] |
5.66e-77 | 97 | 53.712 | WP_084823091 |
hypothetical protein [bacterium A37T11] IPT/TIG domain-containing protein [bacterium A37T11] |
7.33e-77 | 98 | 53.448 | WP_092390596 |
NHL repeat protein,IPT/TIG domain-containing protein [Sphingobacterium sp. Ag1] |
8.02e-77 | 97 | 53.712 | KKO92377 |
hypothetical protein [Sphingobacterium siyangense] hypothetical protein BCY89_14530 [Sphingobacterium siyangense] |
8.19e-77 | 97 | 53.712 | WP_120335672 |
hypothetical protein BGP15_16460 [Sphingobacterium sp. 40-24] |
1.32e-76 | 97 | 53.712 | OJZ13290 |
hypothetical protein [Sinomicrobium sp. N-1-3-6] hypothetical protein DN748_03360 [Sinomicrobium sp. N-1-3-6] |
1.43e-76 | 98 | 52.155 | WP_112370343 |
hypothetical protein [Sphingobacterium sp. M46] hypothetical protein DCO56_19090 [Sphingobacterium sp. M46] |
3.45e-76 | 97 | 53.275 | WP_108635356 |
hypothetical protein [Sphingobacterium detergens] IPT/TIG domain-containing protein [Sphingobacterium detergens] |
5.45e-76 | 97 | 53.275 | WP_120261230 |
hypothetical protein [Sphingobacterium thalpophilum] IPT/TIG domain [Sphingobacterium thalpophilum] |
7.14e-76 | 97 | 52.838 | WP_037532754 |
hypothetical protein [Sphingobacterium sp. CZ-UAM] hypothetical protein BWD42_13105 [Sphingobacterium sp. CZ-UAM] |
7.37e-76 | 97 | 53.275 | WP_077436816 |
hypothetical protein [Zunongwangia atlantica] hypothetical protein IIF7_07501 [Zunongwangia atlantica 22II14-10F7] |
7.84e-76 | 98 | 51.724 | WP_084841070 |
hypothetical protein [Sphingobacterium multivorum] |
1.1e-75 | 96 | 53.540 | WP_153845328 |
hypothetical protein [Sphingobacterium sp. G1-14] |
1.52e-75 | 97 | 53.275 | WP_088163407 |
hypothetical protein [Echinicola rosea] |
1.99e-75 | 98 | 52.586 | WP_137403031 |
hypothetical protein [Echinicola sp. LN3S3] hypothetical protein FKX85_12955 [Echinicola sp. LN3S3] |
3.42e-75 | 98 | 51.724 | WP_141615127 |
hypothetical protein [Arachidicoccus sp. KIS59-12] hypothetical protein D6B99_10450 [Arachidicoccus sp. KIS59-12] |
5.39e-75 | 96 | 50.442 | WP_119987939 |
hypothetical protein [Bacteroides faecis] |
7.11e-75 | 96 | 53.125 | WP_109115507 |
hypothetical protein [Bacteroides thetaiotaomicron] hypothetical protein BT_3476 [Bacteroides thetaiotaomicron VPI-5482] conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] IPT/TIG domain protein [Bacteroides thetaiotaomicron] hypothetical protein BSIG_1192 [Bacteroides thetaiotaomicron] hypothetical protein GAO47_04890 [Bacteroides thetaiotaomicron] hypothetical protein GAO35_21130 [Bacteroides thetaiotaomicron] |
9.2e-75 | 96 | 53.125 | WP_008767664 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein C799_03888 [Bacteroides thetaiotaomicron dnLKV9] hypothetical protein GAN98_22110 [Bacteroides thetaiotaomicron] hypothetical protein GAN67_21935 [Bacteroides thetaiotaomicron] hypothetical protein GAN76_21110 [Bacteroides thetaiotaomicron] hypothetical protein GAN59_21795 [Bacteroides thetaiotaomicron] |
1.04e-74 | 96 | 53.125 | WP_016269385 |
Chain A, Hypothetical hydrolase [Bacteroides thetaiotaomicron] Chain B, Hypothetical hydrolase [Bacteroides thetaiotaomicron] |
2.21e-74 | 96 | 53.125 | 3TC9_A |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF2815_04205 [Bacteroides sp. HMSC068A09] DNA-binding protein [Bacteroides faecis] IPT/TIG domain [Bacteroides thetaiotaomicron] |
6.87e-74 | 96 | 52.174 | WP_055269357 |
hypothetical protein [Bacteroides sp. 3_1_23] conserved hypothetical protein, with a conserved domain protein [Bacteroides sp. 3_1_23] |
2.39e-73 | 98 | 48.750 | WP_008649282 |
hypothetical protein [Echinicola vietnamensis] |
2.6e-73 | 97 | 50.870 | WP_157501772 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein B5E50_15525 [Bacteroides xylanisolvens] |
2.94e-73 | 98 | 48.750 | WP_087322895 |
hypothetical protein [Bacteroides thetaiotaomicron] IPT/TIG domain [Bacteroides thetaiotaomicron] |
3.09e-73 | 96 | 52.232 | WP_055222018 |
hypothetical protein [Bacteroides ovatus] putative uncharacterized protein [Bacteroides ovatus CAG:22] hypothetical protein F3D70_22715 [Bacteroides ovatus] hypothetical protein F3F25_21515 [Bacteroides ovatus] hypothetical protein F3D56_20840 [Bacteroides ovatus] hypothetical protein F3F61_23780 [Bacteroides ovatus] |
3.47e-73 | 98 | 48.750 | WP_022200106 |
NHL repeat protein,IPT/TIG domain-containing protein [Echinicola vietnamensis DSM 17526] |
3.64e-73 | 97 | 50.870 | AGA78966 |
NHL repeat protein [Bacteroides ovatus SD CMC 3f] |
3.69e-73 | 98 | 48.750 | EFF49824 |
hypothetical protein [Bacteroides ovatus] NHL repeat protein [Bacteroides ovatus] |
3.87e-73 | 98 | 48.750 | WP_061447797 |
hypothetical protein [Sphingobacterium sp. M05W1-28] hypothetical protein D7322_16305 [Sphingobacterium sp. M05W1-28] |
5.04e-73 | 97 | 51.092 | WP_121125343 |
hypothetical protein [Bacteroides sp. OF03-11BH] hypothetical protein DXA54_26600 [Bacteroides sp. OF03-11BH] |
1.01e-72 | 98 | 48.333 | WP_120081098 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein GA398_00585 [Bacteroides xylanisolvens] hypothetical protein DW785_18170 [Bacteroides xylanisolvens] |
1.03e-72 | 98 | 48.333 | WP_118196330 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein B5E52_21750 [Bacteroides xylanisolvens] hypothetical protein DW042_12865 [Bacteroides xylanisolvens] |
1.21e-72 | 98 | 48.333 | WP_087319056 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein HMPREF1074_02981 [Bacteroides xylanisolvens CL03T12C04] hypothetical protein GA560_21660 [Bacteroides xylanisolvens] hypothetical protein GA551_22110 [Bacteroides xylanisolvens] hypothetical protein GA562_15130 [Bacteroides xylanisolvens] hypothetical protein GA564_06655 [Bacteroides xylanisolvens] |
1.45e-72 | 98 | 48.333 | WP_008024170 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein GA574_13625 [Bacteroides xylanisolvens] hypothetical protein GAZ38_22990 [Bacteroides xylanisolvens] hypothetical protein GAZ46_01260 [Bacteroides xylanisolvens] hypothetical protein GAZ34_00960 [Bacteroides xylanisolvens] hypothetical protein GAZ23_10605 [Bacteroides xylanisolvens] |
1.48e-72 | 98 | 48.333 | WP_117685132 |
hypothetical protein [Arachidicoccus sp. BS20] hypothetical protein A9P82_06060 [Arachidicoccus sp. BS20] |
1.85e-72 | 96 | 51.327 | WP_066205398 |
hypothetical protein [Bacteroides caecimuri] hypothetical protein E5353_03070 [Bacteroides caecimuri] |
2.27e-72 | 98 | 48.333 | WP_135998949 |
hypothetical protein [Bacteroides caecimuris] hypothetical protein D7W50_23060 [Bacteroides caecimuris] |
2.91e-72 | 98 | 47.917 | WP_120470294 |
hypothetical protein [Dysgonomonas sp. Marseille-P4361] |
8.19e-72 | 96 | 51.542 | WP_108820955 |
DNA-binding protein [Bacteroides sp.] |
1.45e-71 | 99 | 48.927 | HCM09334 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein DWX88_22065 [Bacteroides xylanisolvens] |
1.84e-71 | 98 | 47.917 | WP_134985821 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_183 In lacto CP039121.1
Seq (len = 45 ):
YPVTCSLRGSGNHGISGLADATRINLGGLSSMVSGYHHIAATIAI
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|245610|-1|1825161-1825296
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.6799922669231093
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein Btheta7330_00927 [Bacteroides thetaiotaomicron] hypothetical protein C799_02701 [Bacteroides thetaiotaomicron dnLKV9] hypothetical protein BSIG_3292 [Bacteroides thetaiotaomicron] hypothetical protein HMPREF2534_01591 [Bacteroides thetaiotaomicron] hypothetical protein EH213_01274 [Bacteroides thetaiotaomicron] |
1.07e-25 | 100 | 100.000 | ALJ40503 |
Uncharacterised protein [Bacteroides thetaiotaomicron] Uncharacterised protein [Bacteroides thetaiotaomicron] hypothetical protein SAMN02910322_01444 [Bacteroides thetaiotaomicron] hypothetical protein SAMN02910431_01943 [Bacteroides sp. AR20] |
9.1e-25 | 100 | 98.000 | CUM88257 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein F3F30_15925 [Bacteroides ovatus] hypothetical protein F3F24_16790 [Bacteroides ovatus] hypothetical protein F3D74_15860 [Bacteroides ovatus] hypothetical protein F3D72_15925 [Bacteroides ovatus] hypothetical protein F3D65_06530 [Bacteroides ovatus] |
4.39e-23 | 100 | 94.000 | WP_080598062 |
hypothetical protein HMPREF1070_03673 [Bacteroides ovatus CL03T12C18] Uncharacterised protein [Bacteroides ovatus] hypothetical protein SAMN05216250_102120 [Bacteroides xylanisolvens] |
4.55e-23 | 100 | 94.000 | EIY62806 |
hypothetical protein HMPREF1017_04113 [Bacteroides ovatus 3_8_47FAA] |
4.74e-23 | 100 | 94.000 | EGM99627 |
hypothetical protein BSAG_02590 [Bacteroides sp. D1] hypothetical protein HMPREF0102_01924 [Bacteroides sp. 2_1_22] conserved domain protein [Bacteroides xylanisolvens SD CC 2a] conserved domain protein [Bacteroides xylanisolvens SD CC 1b] hypothetical protein BN891_30020 [Bacteroides xylanisolvens SD CC 2a] |
6.47e-23 | 100 | 92.000 | EEO50879 |
hypothetical protein M088_3555 [Bacteroides ovatus str. 3725 D1 iv] hypothetical protein M082_4022 [Bacteroides fragilis str. 3725 D9 ii] hypothetical protein M089_3843 [Bacteroides ovatus str. 3725 D9 iii] |
2.76e-22 | 100 | 92.000 | KDS12196 |
hypothetical protein [Bacteroides sp. D22] hypothetical protein F3B90_14315 [Bacteroides ovatus] hypothetical protein F3B52_15510 [Bacteroides ovatus] hypothetical protein F3B42_12750 [Bacteroides ovatus] hypothetical protein F3B41_14570 [Bacteroides ovatus] |
6.68e-22 | 100 | 92.000 | WP_083787876 |
hypothetical protein HMPREF0106_00200 [Bacteroides sp. D22] |
7.33e-22 | 100 | 92.000 | EFI15726 |
hypothetical protein [Bacteroides intestinalis] hypothetical protein DW712_12445 [Bacteroides intestinalis] |
3.68e-17 | 100 | 76.000 | WP_118222275 |
putative uncharacterized protein [Prevotella sp. CAG:732] |
9.25e-17 | 98 | 71.429 | CDD18962 |
hypothetical protein [Bacteroides intestinalis] hypothetical protein DWW10_15170 [Bacteroides intestinalis] hypothetical protein DW932_16535 [Bacteroides intestinalis] |
1.57e-16 | 100 | 74.000 | WP_118421745 |
Uncharacterised protein [uncultured Bacteroides sp.] |
1.66e-16 | 98 | 73.469 | SCH41663 |
hypothetical protein [Bacteroides xylanisolvens] hypothetical protein HMPREF9009_02989 [Bacteroides sp. 3_1_13] hypothetical protein DXA05_07790 [Bacteroides sp. AM54-2NS] hypothetical protein DWW25_03595 [Bacteroides xylanisolvens] hypothetical protein DW785_04595 [Bacteroides xylanisolvens] hypothetical protein EAJ13_05065 [Bacteroides xylanisolvens] |
2.58e-16 | 98 | 73.469 | WP_049702575 |
MULTISPECIES: hypothetical protein [Bacteroides] |
2.8e-16 | 98 | 73.469 | WP_153882613 |
hypothetical protein [Bacteroides sp. An51A] hypothetical protein B5G04_06215 [Bacteroides sp. An51A] |
5.82e-16 | 96 | 75.000 | WP_087396275 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein B5F78_01210 [Bacteroides sp. An279] hypothetical protein B5F71_09600 [Bacteroides sp. An269] hypothetical protein B5F25_06975 [Bacteroides sp. An19] putative uncharacterized protein [Bacteroides sp. CAG:702] |
6.01e-16 | 96 | 75.000 | WP_022041137 |
hypothetical protein Bache_0431 [Bacteroides helcogenes P 36-108] |
1.11e-15 | 98 | 73.469 | ADV42458 |
hypothetical protein SAMN05444350_13250 [Bacteroides stercorirosoris] |
5.45e-15 | 98 | 71.429 | SHJ50972 |
hypothetical protein [Bacteroides helcogenes] hypothetical protein Bache_0436 [Bacteroides helcogenes P 36-108] |
3.43e-14 | 100 | 64.000 | WP_013546080 |
hypothetical protein [Fibrobacter succinogenes] hypothetical protein Fisuc_1583 [Fibrobacter succinogenes subsp. succinogenes S85] hypothetical protein FSU_2069 [Fibrobacter succinogenes subsp. succinogenes S85] |
5.22e-14 | 100 | 66.000 | WP_014546264 |
hypothetical protein [Bacteroides timonensis] |
3.3e-13 | 96 | 64.583 | WP_044269767 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein DXB58_02900 [Bacteroides sp. OM05-10AA] hypothetical protein DWY87_01890 [Bacteroides sp. AF27-33] |
3.55e-13 | 92 | 69.565 | WP_122135860 |
hypothetical protein BSCG_03311 [Bacteroides sp. 2_2_4] |
6.56e-13 | 72 | 91.667 | EEO56384 |
conserved domain protein [Bacteroides ovatus SD CMC 3f] |
8.43e-13 | 72 | 91.667 | EFF49741 |
hypothetical protein [Fibrobacter sp. UWB12] hypothetical protein SAMN05720759_101265 [Fibrobacter sp. UWB12] |
1.42e-12 | 100 | 64.000 | WP_072826938 |
MULTISPECIES: hypothetical protein [unclassified Fibrobacter] hypothetical protein SAMN05720467_1984 [Fibrobacter sp. UWB7] hypothetical protein SAMN05720489_3156 [Fibrobacter sp. UWB13] |
1.58e-12 | 100 | 64.000 | WP_073424661 |
hypothetical protein [Fibrobacter sp. UWB11] hypothetical protein SAMN05720758_1581 [Fibrobacter sp. UWB11] |
1.67e-12 | 100 | 64.000 | WP_074208777 |
hypothetical protein [Fibrobacter succinogenes] |
1.69e-12 | 100 | 64.000 | WP_041259984 |
hypothetical protein Fisuc_0342 [Fibrobacter succinogenes subsp. succinogenes S85] |
1.86e-12 | 100 | 64.000 | ACX73954 |
hypothetical protein [Fibrobacter succinogenes] |
1.88e-12 | 96 | 66.667 | WP_041259986 |
hypothetical protein Fisuc_0343 [Fibrobacter succinogenes subsp. succinogenes S85] |
1.94e-12 | 96 | 66.667 | ACX73955 |
conserved hypothetical protein [Fibrobacter succinogenes subsp. succinogenes S85] |
2.52e-12 | 96 | 66.667 | ADL24917 |
hypothetical protein Bache_0441 [Bacteroides helcogenes P 36-108] hypothetical protein HMPREF1204_03954 [Bacteroides fragilis HMW 615] hypothetical protein M116_3855 [Bacteroides fragilis str. 3719 A10] hypothetical protein M107_4014 [Bacteroides fragilis str. 3725 D9(v)] hypothetical protein MB0529_03538 [Bacteroides fragilis] |
3.81e-12 | 100 | 66.000 | ADV42467 |
MULTISPECIES: hypothetical protein [unclassified Fibrobacter] hypothetical protein B7993_08370 [Fibrobacter sp. UWH3] hypothetical protein B7992_09710 [Fibrobacter sp. UWH1] hypothetical protein B0H52_1723 [Fibrobacter sp. UWH8] hypothetical protein SAMN05720766_109112 [Fibrobacter sp. UWH9] hypothetical protein SAMN05720765_112124 [Fibrobacter sp. UWH6] |
4.1e-12 | 100 | 62.000 | WP_073161277 |
hypothetical protein [Bacteroides sp. AF26-7BH] hypothetical protein DWY71_08905 [Bacteroides sp. AF26-7BH] hypothetical protein DXA46_08085 [Bacteroides sp. OF02-3LB] |
7.16e-12 | 92 | 67.391 | WP_117933941 |
hypothetical protein [Fibrobacter sp. UWH4] hypothetical protein SAMN05720762_11410 [Fibrobacter sp. UWH4] |
9.03e-12 | 100 | 62.000 | WP_072980801 |
hypothetical protein HMPREF0106_02423 [Bacteroides sp. D22] hypothetical protein BXY_39070 [Bacteroides xylanisolvens XB1A] Uncharacterised protein [Bacteroides xylanisolvens] |
1.13e-11 | 98 | 65.306 | EFI13405 |
hypothetical protein [Bacteroides sp. An322] hypothetical protein B5F91_10280 [Bacteroides sp. An322] |
1.69e-11 | 96 | 77.083 | WP_087429004 |
hypothetical protein [Fibrobacter sp. UWB12] hypothetical protein SAMN05720759_102357 [Fibrobacter sp. UWB12] |
2.92e-11 | 96 | 64.583 | WP_072827511 |
hypothetical protein [Fibrobacter sp. UWB11] hypothetical protein SAMN05720758_0286 [Fibrobacter sp. UWB11] |
5.57e-11 | 98 | 61.224 | WP_074207877 |
hypothetical protein [Prevotellaceae bacterium] |
6.92e-11 | 96 | 62.500 | HAE24163 |
hypothetical protein [Fibrobacter succinogenes] hypothetical protein Fisuc_2408 [Fibrobacter succinogenes subsp. succinogenes S85] hypothetical protein FSU_2967 [Fibrobacter succinogenes subsp. succinogenes S85] |
8.36e-11 | 96 | 62.500 | WP_014547031 |
hypothetical protein HMPREF9431_02137 [Prevotella oulorum F0390] |
9.69e-11 | 94 | 61.702 | EGV29385 |
hypothetical protein [Fibrobacter succinogenes] hypothetical protein Fisuc_1964 [Fibrobacter succinogenes subsp. succinogenes S85] hypothetical protein FSU_2486 [Fibrobacter succinogenes subsp. succinogenes S85] |
1.22e-10 | 100 | 60.000 | WP_014546622 |
MULTISPECIES: hypothetical protein [unclassified Fibrobacter] hypothetical protein B7991_10690 [Fibrobacter sp. UWB3] hypothetical protein SAMN06298224_2673 [Fibrobacter sp. UWB16] |
2.79e-10 | 98 | 61.224 | WP_088630817 |
hypothetical protein SAMN05444350_116135 [Bacteroides stercorirosoris] |
3.07e-10 | 92 | 63.043 | SHJ15041 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein DWY71_08630 [Bacteroides sp. AF26-7BH] hypothetical protein DXA46_08365 [Bacteroides sp. OF02-3LB] |
7.71e-10 | 92 | 60.870 | WP_117934011 |
hypothetical protein DXD25_16125 [Prevotella sp. TF12-30] |
1.5e-09 | 96 | 56.250 | RGK21418 |
hypothetical protein [Fibrobacter sp. UWH4] hypothetical protein SAMN05720762_102141 [Fibrobacter sp. UWH4] |
1.84e-09 | 96 | 66.667 | WP_072977492 |
hypothetical protein PREVCOP_04998 [Prevotella copri DSM 18205] |
3.55e-09 | 96 | 56.250 | EFB35332 |
hypothetical protein SAMN05444350_12477 [Bacteroides stercorirosoris] |
5.89e-09 | 78 | 69.231 | SHJ36911 |
hypothetical protein SAMN04488493_105108 [Prevotella ruminicola] hypothetical protein SAMN04488494_2649 [Prevotella ruminicola] |
1.2e-08 | 84 | 64.286 | SFC32253 |
hypothetical protein Barb6_01701 [Bacteroidales bacterium Barb6] |
1.87e-08 | 94 | 61.702 | OAV70541 |
hypothetical protein DXA68_08530 [Bacteroides stercorirosoris] |
2.53e-08 | 78 | 66.667 | RGX79158 |
hypothetical protein [Fibrobacter sp. UWB7] hypothetical protein SAMN05720467_3135 [Fibrobacter sp. UWB7] |
3.28e-08 | 96 | 58.333 | WP_073443421 |
hypothetical protein [Fibrobacter sp. UWR2] hypothetical protein B7994_09605 [Fibrobacter sp. UWR2] |
4.26e-08 | 100 | 56.000 | WP_088638241 |
hypothetical protein [Fibrobacter sp. UWEL] hypothetical protein SAMN05720468_107131 [Fibrobacter sp. UWEL] |
4.44e-08 | 100 | 52.000 | WP_073227407 |
hypothetical protein Barb4_02534 [Bacteroidales bacterium Barb4] |
9.68e-08 | 94 | 59.574 | OAV67262 |
hypothetical protein DXA63_15135 [Prevotella copri] |
4.13e-07 | 86 | 55.814 | RGX89367 |
hypothetical protein HMPREF0999_03115 [Parabacteroides sp. D25] hypothetical protein M091_0731 [Parabacteroides distasonis str. 3776 D15 i] hypothetical protein M090_3203 [Parabacteroides distasonis str. 3776 Po2 i] hypothetical protein M092_0702 [Parabacteroides distasonis str. 3776 D15 iv] hypothetical protein BSDG_03058 [Parabacteroides sp. 2_1_7] Uncharacterised protein [Parabacteroides distasonis] |
4.82e-06 | 100 | 50.000 | EKN27069 |
hypothetical protein HMPREF0619_02383 [Parabacteroides sp. D13] |
5.54e-06 | 100 | 50.000 | EEU51168 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_184 In ery NZ_CP036346.1
Seq (len = 60 ):
ILPTSATLNLNTKLIIKAIIIPANEAGNIFPHFLGHKIIIAITSIPKNSASKFTLKPNIR
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|388885|-1|682031-682379
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.13155149866327
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_185 In ery NZ_CP036346.1
Seq (len = 35 ):
MYVVSTKNQINMGMLFQYPINNNLFLSHTSTHCEN
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|361515|-1|1113618-1113726
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6542996094165576
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_186 In ecoli U00096.3
Seq (len = 48 ):
SNVDRTGDTDAVSRHQVADIDSIYFAATTPEFLGYLRDQRSMRVPGRR
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|65343|1|1750364-1750508
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.095825631715836
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_187 In ecoli U00096.3
Seq (len = 39 ):
MDSAETIVVSVWVYQGPIINLPASTCFFTRSLFSGFTAK
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|311639|-1|768162-768342
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9815491676136436
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_188 In ecoli U00096.3
Seq (len = 78 ):
MVRYTSLSTPNEARSESPNQTGSEANSLPTFSGLTVSKKRKPQVSSFLLSASRPLKVRPPITAEIKRIWPSVAEATRL
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|24598|1|662944-663211
Transkriptom
94.0% of gene length expressed over median expression of contig.
ŝ
1.6819366650372383
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 17 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_189 In clostri CP040626.1
Seq (len = 38 ):
MIIGVLHLSHVNHLEKNMKHSSALIKQDFQGVMEILRV
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|28264|1|379910-380030
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.9545466220284853
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_190 In blautia CP039126.1
Seq (len = 94 ):
IKRENLAYDKIVRQIIGKQKGRNDYGIQRSKSRGITIQSIHENRKRMDADHSGYRGKMQYHDCELGRRGCDLGEGCGDRLYPSPALYQRICGCK
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|313902|-1|3889416-3889701
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.721246399047171
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 15 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_191 In blautia CP039126.1
Seq (len = 19 ):
VVCGYRRAEDYIREEEKGR
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|21669|1|564931-564988
Transkriptom
90.0% of gene length expressed over median expression of contig.
ŝ
1.9427143555817852
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_192 In blautia CP039126.1
Seq (len = 6 ):
MSSMQM
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|13850|1|357915-358068
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7189666327522723
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 36 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_193 In bifi AE014295.3
Seq (len = 186 ):
MALLASKRGATCLGQSEPSSASTAATTAAFSSSDSSGAGAATPSSFSTKRAVAASTPLEPVTFSAKASSAAESTTAPPAAPPADGRATATPLSWATTSTAASISLSASGLFCTAAVGSLARSPPRELAPSRVSSSSVASTLATQPSPSCHTLVTRSRMYCCLTPAAPNSERRRSRSASDSTAPNGL
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|57841|-1|1930857-1931463
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6989700043360185
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 10 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Blautia producta] |
4.16e-24 | 100 | 100.000 | WP_018597663 |
hypothetical protein CLOSTASPAR_00879 [[Clostridium asparagiforme] DSM 15981] [[Clostridium] asparagiforme DSM 15981] |
2.65e-21 | 100 | 89.583 | EEG57013 |
hypothetical protein [Hungatella hathewayi] Uncharacterised protein [Hungatella hathewayi] |
1.55e-20 | 100 | 87.500 | WP_155521566 |
hypothetical protein CLOSTASPAR_05003 [[Clostridium asparagiforme] DSM 15981] [[Clostridium] asparagiforme DSM 15981] |
1.85e-20 | 100 | 87.500 | EEG52943 |
hypothetical protein [[Clostridium] asparagiforme] hypothetical protein SAMN05216313_1128 [[Clostridium] lavalense] hypothetical protein SAMN05216313_12676 [[Clostridium] lavalense] |
2.29e-20 | 100 | 87.500 | WP_154660199 |
hypothetical protein EV209_1321 [Cuneatibacter caecimuris] |
3.38e-19 | 100 | 83.333 | RZT00886 |
putative uncharacterized protein [Firmicutes bacterium CAG:882] |
4.76e-19 | 100 | 83.333 | CDD66877 |
hypothetical protein CLFS41_49390 [Clostridium sp. FS41] |
4.84e-15 | 98 | 72.340 | KJJ67315 |
hypothetical protein [Roseburia sp. 1XD42-69] |
9.08e-12 | 98 | 63.830 | WP_158591256 |
Uncharacterised protein [uncultured Clostridium sp.] |
9.44e-10 | 98 | 55.319 | SCJ36480 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_194 In bifi AE014295.3
Seq (len = 33 ):
IRPVSSSPLAPRSSTRAAGSAPTATVTRTSPPR
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|34611|1|1585821-1586031
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.1260984021355385
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_195 In bifi AE014295.3
Seq (len = 79 ):
MVDHRVHGTDTPAKAIHAEYNQRDYQQQHRTGHDTPTTIDGLLLFADPALARLAGTVVLGGPAGWPIGPGAGSACRSRA
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|23591|1|1087409-1087811
Transkriptom
84.0% of gene length expressed over median expression of contig.
ŝ
1.9150664250632836
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Mycobacterium tuberculosis] |
4.6e-21 | 98 | 43.956 | CKR44107 |
Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] |
5.63e-21 | 98 | 43.956 | CKR68811 |
Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] |
1.25e-20 | 98 | 43.956 | CNL83827 |
Uncharacterised protein [Mycobacteroides abscessus subsp. massiliense] |
1.04e-16 | 90 | 43.195 | SKV50493 |
Uncharacterised protein [Mycobacterium tuberculosis] |
3.91e-12 | 70 | 45.385 | CNV34975 |
Uncharacterised protein [Mycobacterium tuberculosis] |
1.67e-09 | 66 | 43.089 | CKS36429 |
Uncharacterised protein [Mycobacterium tuberculosis] |
6.77e-09 | 98 | 35.165 | COW65977 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
8.74e-09 | 48 | 50.000 | SHT64097 |
hypothetical protein C1Y40_02096 [Mycobacterium talmoniae] |
3.66e-08 | 76 | 46.809 | PQM47694 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
7.38e-08 | 48 | 50.000 | SKU79547 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
4.91e-07 | 48 | 50.000 | SHW30429 |
Uncharacterised protein [Mycobacteroides abscessus] |
8.14e-07 | 48 | 50.000 | CPZ85897 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
9.54e-07 | 48 | 50.000 | SKV34804 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
3.03e-06 | 43 | 48.750 | SIL92808 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_196 In bact CP040530.1
Seq (len = 54 ):
IDRVSTVNIGSGTCGRTFDNDADSWQRITGHVCDDSPNHVLGIAICGIRKKHRQ
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|81679|1|1973439-1973628
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.6114251948035918
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_197 In bact CP040530.1
Seq (len = 66 ):
LQRCGDDLQELSVQFHGGAVEYERHDGLSGFILECCTFGYYRYGQFSVRSPDVDVQVCACRHHLIN
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|499889|-1|601323-601800
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.9039014276052404
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_198 In bact CP040530.1
Seq (len = 167 ):
MLYQQEYVLIEVDLFLPDLRKHYIAVAFRYPYLSASLSPVQNRNLNAYLHNLIILQVPVDTGKFTTLSRISYTSKQINATQITTCRSYRIIGLQLTATNILGKRITFQRFIQNHIIFHFTTIYRLGNDRTEDFILSHSQKGTKLEHLGIQITFGFGQRSLCIQCRKF
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|233064|1|5465087-5465702
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.380211241711606
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 18 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) > 3}
Candidate nov_psm6_199 In bact CP040529.1
Seq (len = 135 ):
VRTALPPVEGIFYNGQIFDAYKFATDLVKSARRSIVLIDNYVDETVLLMLSKRSVGVSATIYTQRITQQLQLDLDRHNSQYPPIDIRTYRDSHDRFLIVDETDVYHIGASLKDLGKKMFAFSKLDIPAAVITDLL
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040529.1|15|1|0-459
Transkriptom
96.0% of gene length expressed over median expression of contig.
ŝ
3.204815410317576
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_200 In anaero CP036345.1
Seq (len = 27 ):
DKSLQCHLQRRFKNIFHTGLQDPEDRR
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|91876|1|2324504-2324585
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6868360906864206
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
DNA-binding protein [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
DNA-binding protein [Escherichia coli] |
1.97e-92 | 100 | 100.000 | MSL92713 |
MULTISPECIES: DNA-binding protein [Bacteria] toxin-antitoxin system, toxin component, Fic family [Bacteroides coprocola DSM 17136] toxin-antitoxin system, toxin component, Fic family [Bacteroides plebeius DSM 17135] toxin-antitoxin system, toxin component, Fic family [Bacteroides sp. D1] toxin-antitoxin system, toxin component, Fic family [Parabacteroides sp. D13] toxin-antitoxin system, toxin component, Fic family [Bacteroides sp. 2_1_22] |
8.14e-92 | 100 | 100.000 | WP_007564633 |
MULTISPECIES: DNA-binding protein [Bacteroidales] hypothetical protein HMPREF1059_04418 [Parabacteroides distasonis CL09T03C24] virulence RhuM family protein [Bacteroides fragilis str. S36L11] virulence RhuM family protein [Bacteroides fragilis str. S36L12] virulence RhuM family protein [Bacteroides fragilis str. S36L5] DNA-binding protein [Bacteroides ovatus] virulence RhuM family protein [Parabacteroides distasonis str. 3776 D15 i] virulence RhuM family protein [Parabacteroides distasonis str. 3776 Po2 i] virulence RhuM family protein [Parabacteroides distasonis str. 3999B T(B) 6] virulence RhuM family protein [Parabacteroides distasonis str. 3776 D15 iv] DNA-binding protein [Escherichia coli] DNA-binding protein [Turicibacter sanguinis] |
9.18e-92 | 100 | 100.000 | WP_005868798 |
DNA-binding protein, partial [Bacteroides vulgatus] DNA-binding protein, partial [Bacteroides vulgatus] |
9.38e-92 | 100 | 100.000 | WP_118171347 |
DNA-binding protein [Parabacteroides merdae] |
1.06e-91 | 100 | 100.000 | MTT22609 |
DNA-binding protein [Bacteroides uniformis] DNA-binding protein [Bacteroides uniformis] |
1.17e-91 | 100 | 99.259 | WP_151856415 |
MULTISPECIES: DNA-binding protein [Bacteria] putative DNA-binding protein [Bacteroides thetaiotaomicron VPI-5482] DNA-binding protein [Campylobacter jejuni] toxin-antitoxin system, toxin component, Fic family [Bacteroides vulgatus PC510] toxin-antitoxin system, toxin component, Fic family [Parabacteroides sp. 20_3] hypothetical protein HMPREF1063_05097 [Bacteroides dorei CL02T00C15] hypothetical protein HMPREF1064_05108 [Bacteroides dorei CL02T12C06] hypothetical protein HMPREF1065_04309 [Bacteroides dorei CL03T12C01] hypothetical protein HMPREF1060_04117 [Parabacteroides merdae CL03T12C32] hypothetical protein HMPREF1076_05387 [Parabacteroides goldsteinii CL02T12C30] virulence RhuM family protein [Bacteroides vulgatus str. 3975 RP4] DNA-binding protein [Paeniclostridium sordellii] DNA-binding protein [Faecalibacterium prausnitzii] DNA-binding protein [Escherichia coli] DNA-binding protein [Turicibacter sanguinis] Virulence protein [uncultured Bacteroides sp.] |
1.42e-91 | 100 | 100.000 | WP_005648596 |
DNA-binding protein [Bacteroides vulgatus] virulence RhuM family protein [Bacteroides vulgatus str. 3775 SL(B) 10 (iv)] |
1.57e-91 | 100 | 100.000 | WP_032946733 |
DNA-binding protein [Odoribacter splanchnicus] DNA-binding protein [Odoribacter splanchnicus] DNA-binding protein [Odoribacter splanchnicus] DNA-binding protein [Odoribacter splanchnicus] DNA-binding protein [Odoribacter splanchnicus] |
1.85e-91 | 100 | 100.000 | MRZ86092 |
DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] |
2.43e-91 | 100 | 99.259 | WP_146334764 |
DNA-binding protein [Odoribacter splanchnicus] DNA-binding protein [Odoribacter splanchnicus] DNA-binding protein [Odoribacter splanchnicus] |
3.98e-91 | 100 | 99.259 | WP_118122319 |
DNA-binding protein [Parabacteroides merdae] DNA-binding protein [Parabacteroides merdae] |
5.34e-91 | 100 | 99.259 | WP_122298926 |
DNA-binding protein, partial [Parabacteroides merdae] DNA-binding protein, partial [Parabacteroides merdae] |
5.96e-91 | 100 | 99.259 | WP_122339092 |
MULTISPECIES: DNA-binding protein [Bacteroidales] hypothetical protein BSIG_5428 [Bacteroides thetaiotaomicron] toxin-antitoxin system, toxin component, Fic family [Bacteroides finegoldii DSM 17565] DNA-binding protein [Butyricimonas virosa] DNA-binding protein [Bacteroides vulgatus] |
7.34e-91 | 100 | 99.259 | WP_007756681 |
DNA-binding protein [Odoribacter splanchnicus] putative DNA-binding protein [Odoribacter splanchnicus DSM 20712] putative DNA-binding protein [Odoribacter splanchnicus] |
8.09e-91 | 100 | 99.259 | WP_013611924 |
MULTISPECIES: DNA-binding protein [Bacteroidales] toxin-antitoxin system, toxin component, Fic family [Bacteroides sp. 2_2_4] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides caccae] DNA-binding protein [Bacteroides caccae] DNA-binding protein [Parabacteroides distasonis] |
9.75e-91 | 100 | 99.259 | WP_008777459 |
MULTISPECIES: DNA-binding protein [Bacteroidales] DNA-binding protein [Bacteroides caccae] DNA-binding protein [Tannerella sp. AF04-6] DNA-binding protein [Bacteroides cellulosilyticus] DNA-binding protein [Bacteroides sp. AF39-10AT] DNA-binding protein [Bacteroides dorei] |
1.11e-90 | 100 | 99.259 | WP_117682277 |
DNA-binding protein, partial [Bacteroides xylanisolvens] DNA-binding protein, partial [Bacteroides xylanisolvens] |
1.65e-90 | 100 | 98.519 | WP_117811894 |
MULTISPECIES: DNA-binding protein [Bacteroidales] DNA-binding protein [Bacteroides caccae] DNA-binding protein [Bacteroides intestinalis] DNA-binding protein [Bacteroides intestinalis] DNA-binding protein [Parabacteroides sp. AM18-12LB] DNA-binding protein [Bacteroides dorei] |
1.9e-90 | 100 | 98.519 | WP_074784307 |
DNA-binding protein [Campylobacter jejuni] |
2.2e-90 | 99 | 99.254 | EAL4029745 |
DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Paraprevotella clara] DNA-binding protein [Bacteroides vulgatus] |
1.71e-89 | 100 | 97.037 | WP_118147821 |
DNA-binding protein [Bacteroides sp. An51A] DNA-binding protein [Bacteroides sp. An51A] |
8.68e-81 | 100 | 85.926 | WP_087398155 |
MULTISPECIES: DNA-binding protein [Bacteroidales] toxin-antitoxin system, toxin component, Fic family [Bacteroides sp. 3_1_19] hypothetical protein HMPREF0999_04341 [Parabacteroides sp. D25] hypothetical protein BSDG_04269 [Parabacteroides sp. 2_1_7] DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] |
8.35e-80 | 100 | 84.444 | WP_008781192 |
MULTISPECIES: DNA-binding protein [Parabacteroides] DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides sp. AF39-10AC] DNA-binding protein [Parabacteroides distasonis] |
2.72e-78 | 100 | 83.704 | WP_122140431 |
DNA-binding protein [Bacteroides sp. AF25-38AC] DNA-binding protein [Bacteroides sp. AF25-38AC] |
3.37e-77 | 100 | 83.704 | WP_120178253 |
MULTISPECIES: DNA-binding protein [Bacteroides] DNA-binding protein [Bacteroides plebeius] DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides plebeius] DNA-binding protein [Bacteroides plebeius] |
4.11e-77 | 100 | 82.222 | WP_117748275 |
DNA-binding protein [Bacteroides plebeius] DNA-binding protein [Bacteroides plebeius] |
3.08e-75 | 100 | 80.000 | WP_117748726 |
DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] |
1.8e-74 | 100 | 77.037 | WP_134854999 |
MULTISPECIES: DNA-binding protein [Bacteroides] toxin-antitoxin system, toxin component, Fic family [Bacteroides dorei DSM 17855] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides dorei] |
1.82e-74 | 100 | 77.037 | WP_007833763 |
DNA-binding protein [Bacteroides sp. An269] DNA-binding protein [Bacteroides sp. An269] |
2.37e-74 | 100 | 80.000 | WP_087211650 |
MULTISPECIES: DNA-binding protein [Bacteroides] virulence RhuM family protein [Bacteroides dorei] virulence RhuM family protein [Bacteroides dorei] virulence RhuM family protein [Bacteroides dorei] virulence RhuM family protein [Bacteroides dorei] virulence RhuM family protein [Bacteroides dorei] |
2.69e-74 | 100 | 80.741 | WP_118038441 |
DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] |
2.75e-74 | 100 | 77.037 | WP_118290139 |
MULTISPECIES: DNA-binding protein [Bacteroides] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides sp. AF25-18] |
2.97e-74 | 100 | 77.037 | WP_118037773 |
MULTISPECIES: DNA-binding protein [Bacteroides] DNA-binding protein [Bacteroides dorei CL03T12C01] toxin-antitoxin system, toxin component, Fic family [Bacteroides dorei 5_1_36/D4] uncharacterized protein BN543_01536 [Bacteroides dorei CAG:222] DNA-binding protein [Bacteroides dorei] hypothetical protein BSBG_00894 [Bacteroides sp. 9_1_42FAA] |
6.73e-74 | 100 | 77.037 | WP_007841367 |
MULTISPECIES: DNA-binding protein [Bacteroides] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides sp. 3_1_33FAA] DNA-binding protein [Bacteroides sp. 3_1_33FAA] |
6.96e-74 | 100 | 77.037 | WP_117596082 |
DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] |
8.21e-74 | 100 | 76.296 | WP_118409898 |
DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides dorei] |
1.72e-73 | 100 | 76.296 | WP_118429116 |
DNA-binding protein [Bacteroides eggerthii] DNA-binding protein [Bacteroides eggerthii] DNA-binding protein [Bacteroides eggerthii] DNA-binding protein [Bacteroides eggerthii] |
2.03e-73 | 100 | 77.778 | WP_130089081 |
DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] DNA-binding protein [Bacteroides vulgatus] |
2.5e-73 | 100 | 75.556 | WP_151849199 |
DNA-binding protein [Bacteroides sp. NMBE5] |
3.56e-73 | 100 | 77.037 | WP_110506540 |
DNA-binding protein [Parabacteroides sp. D26] hypothetical protein HMPREF1000_04012 [Parabacteroides sp. D26] |
3.89e-73 | 100 | 77.037 | WP_048928638 |
DNA-binding protein [Bacteroides helcogenes] putative DNA-binding protein [Bacteroides helcogenes P 36-108] |
3.9e-73 | 100 | 77.778 | WP_013546496 |
putative DNA-binding protein [Parabacteroides sp. CAG:409] |
3.95e-73 | 100 | 77.037 | CDE60709 |
DNA-binding protein [Bacteroides sp.] |
3.96e-73 | 100 | 74.815 | HAZ50658 |
virulence RhuM family protein [Porphyromonadaceae bacterium] |
6.4e-73 | 100 | 77.778 | WP_148464538 |
DNA-binding protein [Bacteroides helcogenes] putative DNA-binding protein [Bacteroides helcogenes P 36-108] |
6.46e-73 | 100 | 77.778 | WP_013546498 |
MULTISPECIES: DNA-binding protein [Bacteroides] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides dorei] toxin-antitoxin system, toxin component, Fic family [Bacteroides sp. 3_1_33FAA] DNA-binding protein [Bacteroides dorei] DNA-binding protein [Bacteroides dorei] |
1.12e-72 | 100 | 75.556 | WP_008654332 |
DNA-binding protein [Parabacteroides distasonis] |
1.24e-72 | 82 | 100.000 | MRZ78752 |
DNA-binding protein [Bacteroides dorei] hypothetical protein HMPREF1063_03029 [Bacteroides dorei CL02T00C15] hypothetical protein HMPREF1064_01797 [Bacteroides dorei CL02T12C06] |
2.19e-72 | 100 | 76.296 | WP_007848160 |
DNA-binding protein [Bacteroides vulgatus] virulence RhuM family protein [Bacteroides vulgatus] virulence RhuM family protein [Bacteroides vulgatus] virulence RhuM family protein [Bacteroides vulgatus] virulence RhuM family protein [Bacteroides vulgatus] |
5.05e-72 | 100 | 77.037 | WP_151851435 |
DNA-binding protein [Parabacteroides distasonis] DNA-binding protein [Parabacteroides distasonis] |
6.14e-72 | 100 | 76.296 | WP_122268139 |
toxin-antitoxin system, toxin component, Fic family [Bacteroides dorei 5_1_36/D4] |
1e-71 | 100 | 77.037 | EEO47937 |
DNA-binding protein [Bacteroides thetaiotaomicron] |
1.64e-71 | 100 | 78.519 | WP_129655625 |
DNA-binding protein [Bacteroides helcogenes] putative DNA-binding protein [Bacteroides helcogenes P 36-108] |
1.83e-71 | 100 | 76.296 | WP_013546082 |
DNA-binding protein [Bacteroides thetaiotaomicron] |
1.93e-71 | 100 | 78.519 | WP_054960729 |
DNA-binding protein [Bacteroides helcogenes] putative DNA-binding protein [Bacteroides helcogenes P 36-108] |
2.3e-71 | 100 | 75.556 | WP_013546497 |
DNA-binding protein [Parabacteroides massiliensis] |
1.11e-70 | 99 | 76.692 | WP_075967822 |
DNA-binding protein [Bacteroides stercoris] DNA-binding protein [Bacteroides stercoris] |
1.11e-70 | 100 | 77.037 | WP_117742236 |
DNA-binding protein [Bacteroides salanitronis] putative DNA-binding protein [Bacteroides salanitronis DSM 18170] |
1.38e-70 | 100 | 75.556 | WP_013618456 |
DNA-binding protein [Bacteroides faecis] virulence RhuM family protein [Bacteroides faecis] DNA-binding protein [Bacteroides faecis] |
1.89e-70 | 100 | 77.778 | WP_130062026 |
DNA-binding protein [Bacteroides fragilis] virulence RhuM family protein [Bacteroides fragilis str. 2-F-2 #5] virulence RhuM family protein [Bacteroides fragilis str. 2-F-2 #7] virulence RhuM family protein [Bacteroides fragilis str. 34-F-2 #13] virulence RhuM family protein [Bacteroides fragilis str. 2-F-2 #4] |
5.62e-70 | 100 | 71.111 | WP_032571941 |
DNA-binding protein [Bacteroides ovatus] virulence RhuM family protein [Bacteroides fragilis str. 3725 D9 ii] virulence RhuM family protein [Bacteroides ovatus str. 3725 D1 iv] DNA-binding protein [Bacteroides ovatus] |
8.67e-70 | 100 | 77.037 | WP_143255165 |
MULTISPECIES: DNA-binding protein [Bacteroides] DNA-binding protein [Bacteroides uniformis] DNA-binding protein [Bacteroides uniformis] DNA-binding protein [Bacteroides uniformis] DNA-binding protein [Bacteroides sp. AF25-38AC] |
9.86e-70 | 100 | 78.519 | WP_117952227 |
unnamed protein product |
1.03e-69 | 100 | 77.037 | WP_032854466 |
putative dNA-binding protein [Bacteroides fragilis str. 3976T8] |
5.53e-69 | 100 | 71.111 | EXZ75172 |
MULTISPECIES: DNA-binding protein [Bacteroides] DNA-binding protein [Bacteroides uniformis] DNA-binding protein [Bacteroides uniformis] DNA-binding protein [Bacteroides sp. AF18-33] DNA-binding protein [Bacteroides uniformis] |
5.64e-69 | 100 | 77.778 | WP_117974805 |
putative DNA-binding domain protein, partial [Bacteroides fragilis str. 2-F-2 #4] |
9.35e-69 | 100 | 71.111 | EXZ41659 |
DNA-binding protein [Bacteroides ovatus] virulence RhuM family protein [Bacteroides ovatus str. 3725 D9 iii] |
1.2e-68 | 100 | 76.296 | WP_155272577 |
DNA-binding protein, partial [Bacteroides thetaiotaomicron] |
1.52e-68 | 78 | 100.000 | KAB4400643 |
DNA-binding protein [Bacteroides sp. AM23-18] DNA-binding protein [Bacteroides sp. AM23-18] |
1.57e-68 | 100 | 74.074 | WP_117475853 |
virulence RhuM family protein [Bacteroides fragilis str. 2-F-2 #5] virulence RhuM family protein [Bacteroides fragilis str. 2-F-2 #7] virulence RhuM family protein [Bacteroides fragilis str. 34-F-2 #13] virulence RhuM family protein [Bacteroides fragilis str. 2-F-2 #4] virulence RhuM family protein [Bacteroides fragilis str. 20793-3] DNA-binding protein [Bacteroides fragilis] |
3.96e-68 | 100 | 71.111 | EXY20166 |
DNA-binding protein [Bacteroides fragilis] virulence RhuM family protein [Bacteroides fragilis str. J-143-4] |
4.78e-68 | 100 | 71.111 | WP_032564557 |
DNA-binding protein, partial [Bacteroides fragilis] |
6.52e-68 | 100 | 71.111 | WP_057059220 |
virulence RhuM family protein [Bacteroides fragilis str. 3988T(B)14] virulence RhuM family protein [Bacteroides fragilis str. 3988 T1] virulence RhuM family protein [Bacteroides fragilis str. S23 R14] virulence RhuM family protein [Bacteroides fragilis str. S23L24] virulence RhuM family protein [Bacteroides fragilis str. S23L17] |
7.55e-68 | 100 | 70.370 | EXY75913 |
DNA-binding protein [Bacteroidia bacterium 43-41] |
7.8e-68 | 100 | 71.111 | OJV38529 |
DNA-binding protein [Bacteroides fragilis] virulence RhuM family protein [Bacteroides fragilis str. B1 (UDC16-1)] |
8.19e-68 | 100 | 71.111 | WP_042985930 |
putative dNA-binding protein [Bacteroides fragilis str. Ds-233] |
1.05e-67 | 100 | 71.111 | EXZ16255 |
DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] |
1.06e-67 | 100 | 71.111 | WP_032535497 |
DNA-binding protein [Bacteroides fragilis] hypothetical protein HMPREF1203_04622 [Bacteroides fragilis HMW 610] |
1.1e-67 | 100 | 71.111 | WP_005812676 |
DNA-binding protein [Bacteroides fragilis] virulence RhuM family protein [Bacteroides fragilis str. DS-71] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] |
1.47e-67 | 100 | 71.111 | WP_032589612 |
DNA-binding protein [Bacteroides fragilis] virulence RhuM family protein [Bacteroides fragilis str. DS-208] virulence RhuM family protein [Bacteroides fragilis str. DS-71] virulence RhuM family protein [Bacteroides fragilis str. A7 (UDC12-2)] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] |
1.72e-67 | 100 | 71.111 | WP_025813910 |
hypothetical protein HMPREF1055_02470 [Bacteroides fragilis CL07T00C01] hypothetical protein HMPREF1079_01720 [Bacteroides fragilis CL05T00C42] hypothetical protein HMPREF1056_00448 [Bacteroides fragilis CL07T12C05] hypothetical protein HMPREF1080_00376 [Bacteroides fragilis CL05T12C13] |
1.87e-67 | 100 | 71.111 | EIK38950 |
DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] |
2.19e-67 | 100 | 71.111 | OCR41209 |
hypothetical protein HMPREF1018_00385 [Bacteroides fragilis] hypothetical protein HMPREF1067_00871 [Bacteroides fragilis CL03T12C07] hypothetical protein HMPREF1066_00374 [Bacteroides fragilis CL03T00C08] virulence protein RhuM family protein [Bacteroides fragilis] virulence protein RhuM family protein [Bacteroides fragilis] |
2.8e-67 | 100 | 70.370 | EGN06770 |
DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] |
2.82e-67 | 100 | 71.111 | WP_130071562 |
DNA-binding protein [Bacteroides fragilis] putative DNA-binding protein [Bacteroides fragilis YCH46] virulence RhuM family protein [Bacteroides fragilis str. 3783N1-2] virulence RhuM family protein [Bacteroides fragilis str. 3783N2-1] virulence RhuM family protein [Bacteroides fragilis str. 3976T7] virulence RhuM family protein [Bacteroides fragilis str. 3725 D9(v)] virulence RhuM family protein [Bacteroides fragilis str. 3783N1-8] virulence RhuM family protein [Bacteroides fragilis str. J38-1] virulence RhuM family protein [Bacteroides fragilis str. Korea 419] virulence RhuM family protein [Bacteroides fragilis str. S24L15] virulence RhuM family protein [Bacteroides fragilis str. S24L26] virulence RhuM family protein [Bacteroides fragilis str. S24L34] virulence RhuM family protein [Bacteroides fragilis str. 3783N1-6] |
3.03e-67 | 100 | 70.370 | WP_011201977 |
DNA-binding protein [Bacteroides fragilis] virulence RhuM family protein [Bacteroides fragilis str. 3996 N(B) 6] virulence RhuM family protein [Bacteroides fragilis str. 3998T(B)3] virulence RhuM family protein [Bacteroides fragilis str. 3998 T(B) 4] DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] |
4.63e-67 | 100 | 70.370 | WP_032577444 |
DNA-binding protein [Bacteroides fragilis] |
4.74e-67 | 100 | 70.370 | OCR38492 |
DNA-binding protein [Bacteroides fragilis] |
1.06e-66 | 100 | 70.370 | WP_134994286 |
DNA-binding protein [Bacteroides fragilis] DNA-binding protein [Bacteroides fragilis] |
1.5e-66 | 100 | 69.630 | WP_115473382 |
DNA-binding protein, partial [Bacteroides fragilis] |
1.85e-66 | 100 | 71.111 | WP_032600181 |
MULTISPECIES: DNA-binding protein [Bacteroides] virulence RhuM family protein [Bacteroides fragilis str. 3986T(B)10] virulence RhuM family protein [Bacteroides fragilis str. 3986 T(B)9] virulence RhuM family protein [Bacteroides fragilis str. 3986 N(B)22] virulence RhuM family protein [Bacteroides fragilis str. 3986 T(B)13] virulence RhuM family protein [Bacteroides fragilis str. 3986 N3] |
2.22e-66 | 100 | 70.370 | WP_008769262 |
hypothetical protein BSHG_1227 [Bacteroides sp. 3_2_5] conserved hypothetical protein [Bacteroides fragilis 638R] |
2.27e-66 | 100 | 70.370 | EES88308 |
DNA-binding protein [Bacteroides sp. CAG:1060_57_27] |
6.45e-65 | 100 | 71.111 | OKZ01925 |
DNA-binding protein [Parabacteroides distasonis] Virulence protein [Parabacteroides distasonis] |
8.46e-65 | 95 | 71.875 | WP_057319886 |
hypothetical protein [Bacteroidales bacterium] |
6.2e-64 | 100 | 66.667 | HBS88927 |
DNA-binding protein [Proteiniphilum acetatigenes] |
1.21e-63 | 97 | 70.992 | WP_026327681 |
DNA-binding protein [Parabacteroides goldsteinii] |
7.39e-63 | 93 | 70.635 | WP_129734436 |
DNA-binding protein [Bacteroidetes bacterium GWF2_38_335] DNA-binding protein [Bacteroidales bacterium] |
8.42e-63 | 100 | 66.667 | OFY37212 |
DNA-binding protein [Parabacteroides sp. TM07-1AC] DNA-binding protein [Parabacteroides sp. TM07-1AC] |
1.69e-62 | 93 | 70.635 | WP_122362589 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_201 In anaero CP036345.1
Seq (len = 451 ):
MRYAIKNDYEKLVIYHDYEGISKWCTGEWKAKKKGTQDYKELFENVSKKLKVEFVKVQGHSGDKYNDIADMLAKKVIFGEEAKDQREESCGELKRNVYINRNLDELYGMLLNKGTILWESFKGGNIKSIGNQKRFEFFVDGKKAFLDIHQRRDGTTTFNPTGTNIEYSTLLKEAIEKCGVRNTSENKNYTIYLGEEWCRNVLEYLKQLPDVKVKDISDKNKKAYQFVSKIGDRLTLSLYDYKVMVQGKPLYLYHEFLSFISHAPQVTVNDVVDLTNTFNDTIGEASDTKAKMGELLPTAYNDGKIEETIWKLFSPSIILIEDEKKLDDYSACVFPALRALEGYLKLLLNVKGIVVDKNHTFGSVFKPERKGDETSNHILIQKYKTLINNSTFEQVLEEIYNYFRKNRHTIFHVDQVIIATRLIEEKQEAKDIFAQIVYLIENTYRRVESEL
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|46318|1|1108953-1110690
Transkriptom
44.0% of gene length expressed over median expression of contig.
ŝ
4.5216740441419665
unique PSMS
6
unique PSMS
6
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_202 In anaero CP036345.1
Seq (len = 23 ):
MDILPTQSAAIREIIIISYRTYL
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|262612|-1|344664-344742
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.143271109617117
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
reverse transcriptase-like protein [Blautia obeum]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Anaerostipes caccae] ribonuclease HI [Anaerostipes caccae DSM 14662] |
0.0 | 100 | 100.000 | WP_006569073 |
reverse transcriptase-like protein [Blautia obeum] Ribonuclease H [Blautia obeum] |
4.14e-148 | 99 | 49.339 | WP_070102678 |
hypothetical protein [Dorea formicigenerans] hypothetical protein DW860_12285 [Dorea formicigenerans] hypothetical protein DW854_11550 [Dorea formicigenerans] |
1.4e-147 | 99 | 48.678 | WP_118359271 |
reverse transcriptase-like protein [Anaerobutyricum hallii] Ribonuclease H [Anaerobutyricum hallii] |
1.78e-142 | 99 | 45.534 | WP_070101389 |
hypothetical protein [Lachnospiraceae bacterium GAM79] |
1.83e-106 | 99 | 40.351 | WP_119623792 |
hypothetical protein [Anaerobacillus alkalilacustris] hypothetical protein BKP37_02335 [Anaerobacillus alkalilacustris] |
2.84e-106 | 98 | 39.111 | WP_071308088 |
hypothetical protein [Lachnospiraceae bacterium Marseille-P3773] |
9.18e-104 | 99 | 41.099 | WP_099468749 |
hypothetical protein [Clostridioides difficile] hypothetical protein BGU15_16390 [Clostridioides difficile] ribonuclease HI [Clostridioides difficile] ribonuclease HI [Clostridioides difficile] |
3.48e-98 | 99 | 38.852 | WP_095893002 |
hypothetical protein [Clostridioides difficile] |
3.17e-97 | 99 | 38.631 | WP_143476881 |
MULTISPECIES: hypothetical protein [unclassified Butyricicoccus] hypothetical protein DWY17_12405 [Butyricicoccus sp. AF24-19AC] hypothetical protein DWX95_03050 [Butyricicoccus sp. AF22-28AC] hypothetical protein DWW41_04830 [Butyricicoccus sp. AF15-40] |
3.2e-77 | 99 | 34.498 | WP_118564627 |
ribonuclease HI [Ruminococcus sp. CAG:624] |
1.45e-68 | 99 | 34.267 | CDF00583 |
Uncharacterised protein [uncultured Clostridium sp.] |
2.67e-49 | 78 | 34.540 | SCH46790 |
hypothetical protein [Turicibacter sanguinis] Uncharacterised protein [Turicibacter sanguinis] |
1.42e-46 | 70 | 34.891 | WP_055165792 |
hypothetical protein [Butyricicoccus sp. OM06-6AC] hypothetical protein DXB94_05300 [Butyricicoccus sp. OM06-6AC] |
2.33e-43 | 78 | 30.769 | WP_117751358 |
hypothetical protein [Bacillus halodurans] hypothetical protein E2L07_14485 [Bacillus halodurans] |
3.99e-43 | 78 | 34.239 | WP_134229915 |
hypothetical protein [Butyrivibrio hungatei] hypothetical protein bhn_I1198 [Butyrivibrio hungatei] |
1.92e-41 | 73 | 32.353 | WP_071175941 |
hypothetical protein [Bacillus oceanisediminis] RnlA-like RNase toxin of RnlAB toxin-antitoxin system [Bacillus oceanisediminis] |
1.78e-35 | 79 | 29.973 | WP_110066200 |
hypothetical protein [Aminipila sp. JN-18] hypothetical protein EQM06_04080 [Aminipila sp. JN-18] |
2.25e-34 | 55 | 35.094 | WP_128745124 |
hypothetical protein [Bacillus altitudinis] hypothetical protein [Bacillus sp. HR216] |
4.68e-34 | 76 | 32.240 | WP_144626006 |
hypothetical protein [Bacillus sp. BHET2] hypothetical protein FGG79_19005 [Bacillus sp. BHET2] |
2.51e-31 | 73 | 31.672 | WP_138781257 |
hypothetical protein [Bacillus cereus] hypothetical protein CON08_19790 [Bacillus cereus] |
5.99e-31 | 73 | 30.499 | WP_098021347 |
MULTISPECIES: hypothetical protein [unclassified Paenibacillus] RNase LS, toxin [Paenibacillus sp. RU5A] RNase LS, toxin [Paenibacillus sp. RU26A] RNase LS, toxin [Paenibacillus sp. RU5M] |
3.76e-28 | 74 | 29.882 | WP_079697003 |
type II toxin-antitoxin system RnlA family toxin [Bacteroides salyersiae] hypothetical protein HMPREF1532_01209 [Bacteroides salyersiae WAL 10018 = DSM 18765 = JCM 12988] |
4.75e-27 | 68 | 31.090 | WP_005926183 |
hypothetical protein [Caldisalinibacter kiritimatiensis] hypothetical protein L21TH_1946 [Caldisalinibacter kiritimatiensis] |
7.68e-27 | 71 | 28.402 | WP_006314939 |
hypothetical protein [Salegentibacter sp. 24] RnlA-like RNase toxin of RnlAB toxin-antitoxin system [Salegentibacter sp. 24] |
1.61e-26 | 68 | 29.808 | WP_133546807 |
hypothetical protein [Paeniclostridium sordellii] |
6.44e-26 | 70 | 29.538 | WP_081013669 |
hypothetical protein [Pseudomonas otitidis] |
6.89e-26 | 17 | 63.636 | MWK60533 |
hypothetical protein ATCC9714_02821 [[Clostridium] sordellii] [Paeniclostridium sordellii] Uncharacterised protein [[Clostridium] sordellii] [Paeniclostridium sordellii] Uncharacterised protein [[Clostridium] sordellii] [Paeniclostridium sordellii] Uncharacterised protein [[Clostridium] sordellii] [Paeniclostridium sordellii] |
6.93e-26 | 70 | 29.538 | CEJ72394 |
hypothetical protein [Paenibacillus sp. FSL R5-0345] hypothetical protein R50345_04935 [Paenibacillus sp. FSL R5-0345] |
7.72e-26 | 68 | 30.351 | WP_042124555 |
hypothetical protein [Arcobacter cryaerophilus] toxin-antitoxin system, toxin component, RnlA family [Arcobacter cryaerophilus] |
1.05e-25 | 72 | 30.588 | WP_148572114 |
hypothetical protein [Maribacter sp. MAR_2009_72] RnlA-like RNase toxin of RnlAB toxin-antitoxin system [Maribacter sp. MAR_2009_72] |
1.33e-25 | 70 | 27.187 | WP_144800580 |
MULTISPECIES: reverse transcriptase-like protein [unclassified Bacteria (miscellaneous)] reverse transcriptase-like protein [bacterium D16-36] reverse transcriptase-like protein [bacterium 1xD8-6] |
2.02e-25 | 17 | 61.039 | WP_120439026 |
hypothetical protein [Arcobacter butzleri] hypothetical protein AF76_08200 [Arcobacter butzleri L351] hypothetical protein AF75_04520 [Arcobacter butzleri L350] |
7.9e-25 | 72 | 29.882 | WP_046991968 |
reverse transcriptase-like protein [Firmicutes bacterium] |
8.96e-25 | 17 | 59.740 | WP_154939964 |
reverse transcriptase-like protein [Bacilliculturomica massiliensis] |
8.96e-25 | 17 | 59.740 | WP_130862259 |
reverse transcriptase-like protein [Lachnospiraceae bacterium TWA4] Ribonuclease HI-related protein [Lachnospiraceae bacterium TWA4] |
9.38e-25 | 17 | 64.935 | WP_042735502 |
reverse transcriptase-like protein [Anaerostipes rhamnosivorans] Ribonuclease HI-related protein [Anaerostipes rhamnosivorans] |
1.53e-24 | 17 | 61.039 | WP_137328704 |
hypothetical protein [Mucilaginibacter sp. ZH6] hypothetical protein DYU05_06265 [Mucilaginibacter sp. ZH6] |
2.1e-24 | 69 | 28.391 | WP_117382103 |
type II toxin-antitoxin system RnlA family toxin [Bacteroides neonati] |
5.59e-24 | 69 | 29.936 | WP_042369632 |
hypothetical protein [Antarcticibacterium sp. PAMC 28998] hypothetical protein FK178_02805 [Antarcticibacterium sp. PAMC 28998] |
6.81e-24 | 67 | 29.412 | WP_146830797 |
reverse transcriptase-like protein [Lachnospiraceae bacterium AM26-1LB] RNase H [Lachnospiraceae bacterium AM26-1LB] |
8.24e-24 | 17 | 61.039 | WP_118739203 |
hypothetical protein [Desulfuromonas sp. TF] |
1.07e-23 | 68 | 28.065 | WP_027716485 |
RNase H [Lachnospiraceae bacterium] |
1.1e-23 | 17 | 54.545 | HCT89768 |
MULTISPECIES: reverse transcriptase-like protein [Anaerostipes] ribonuclease HI [Anaerostipes caccae DSM 14662] RNase H [Anaerostipes sp. AF04-45] ribonuclease HI [Anaerostipes sp. CAG:276] |
1.15e-23 | 17 | 59.740 | WP_006567009 |
MULTISPECIES: reverse transcriptase-like protein [unclassified Clostridium] RNase H [Lachnospiraceae bacterium TF01-11] RNase H [Clostridium sp. CAG:12237_41] RNase H [Clostridium sp. AM27-31LB] RNase H [Clostridium sp. TF01-11] |
1.16e-23 | 17 | 57.143 | WP_055943843 |
ribonuclease HI [Anaerostipes caccae] |
1.35e-23 | 17 | 59.740 | EFV22904 |
reverse transcriptase-like protein [Clostridium sp. AF34-13] RNase H [Clostridium sp. AF34-13] |
1.35e-23 | 17 | 57.143 | WP_118498188 |
reverse transcriptase-like protein [Anaerostipes sp. 494a] RNase H [Anaerostipes sp. 494a] |
1.57e-23 | 17 | 58.442 | WP_075758837 |
reverse transcriptase-like protein [Parasporobacterium paucivorans] |
1.64e-23 | 17 | 58.974 | WP_073993760 |
reverse transcriptase-like protein [Lachnospiraceae bacterium] |
1.7e-23 | 17 | 59.740 | WP_148460023 |
ribonuclease HI [Lachnospiraceae bacterium] |
2.34e-23 | 17 | 61.039 | HBA97282 |
Ribonuclease H [uncultured Blautia sp.] |
2.66e-23 | 17 | 58.442 | SCH07106 |
ribonuclease HI [Parasporobacterium paucivorans DSM 15970] |
2.93e-23 | 17 | 58.974 | SHJ17917 |
reverse transcriptase-like protein [Ruminococcus sp. AF31-8BH] RNase H [Ruminococcus sp. AF31-8BH] predicted double-stranded RNA/RNA-DNA hybrid binding protein [Ruminococcus sp. CAG:60] |
3e-23 | 17 | 58.442 | WP_021926555 |
reverse transcriptase-like protein [Lachnoanaerobaculum sp.] |
3.03e-23 | 17 | 61.039 | RKW32859 |
reverse transcriptase-like protein [Anaerostipes sp. BG01] |
3.34e-23 | 17 | 59.740 | WP_024727605 |
reverse transcriptase-like protein [Peptostreptococcus russellii] ribonuclease HI [Peptostreptococcus russellii] |
4.19e-23 | 18 | 60.000 | WP_091973369 |
RNase H [Clostridiales bacterium 36_14] |
4.25e-23 | 17 | 59.740 | OKZ75454 |
Ribonuclease H [uncultured Clostridium sp.] |
4.4e-23 | 18 | 56.962 | SCH46825 |
ribonuclease HI [Eubacteriaceae bacterium] ribonuclease HI [Eubacterium sp. CAG:603] Ribonuclease H [uncultured Eubacterium sp.] |
4.49e-23 | 17 | 61.538 | WP_021982747 |
hypothetical protein AN396_05945 [Epulopiscium sp. SCG-B11WGA-EpuloA1] hypothetical protein AN396_03330 [Epulopiscium sp. SCG-B11WGA-EpuloA1] hypothetical protein AN639_00020 [Epulopiscium sp. SCG-B05WGA-EpuloA1] |
4.68e-23 | 17 | 62.338 | ONI40515 |
ribonuclease HI [Clostridium sp. CAG:122] |
4.72e-23 | 17 | 55.844 | CCZ42638 |
hypothetical protein AN640_06080 [Epulopiscium sp. SCG-D08WGA-EpuloA1] hypothetical protein ATN32_05570 [Epulopiscium sp. AS2M-Bin002] |
4.81e-23 | 17 | 58.442 | ONI43868 |
reverse transcriptase-like protein [Eubacteriaceae bacterium] Ribonuclease H [uncultured Eubacterium sp.] |
4.84e-23 | 17 | 59.740 | WP_147605945 |
RNase H [Anaerostipes hadrus] |
5.22e-23 | 17 | 59.740 | HAR77231 |
reverse transcriptase-like protein [Anaerostipes hadrus] RNase H [Firmicutes bacterium AF12-30] predicted double-stranded RNA/RNA-DNA hybrid binding protein [Firmicutes bacterium CAG:270] Ribonuclease H [Anaerostipes hadrus] |
5.57e-23 | 17 | 59.740 | WP_022375472 |
hypothetical protein [Nostoc commune] mRNA endoribonuclease LS [Nostoc commune HK-02] mRNA endoribonuclease LS [Nostoc commune NIES-4072] |
6.67e-23 | 70 | 27.515 | WP_146195849 |
reverse transcriptase-like protein [Anaerostipes hadrus] reverse transcriptase-like protein [Anaerostipes hadrus] |
6.74e-23 | 17 | 59.740 | WP_149884029 |
ribonuclease HI [Catonella morbi] ribonuclease HI [Catonella morbi ATCC 51271] |
7.52e-23 | 17 | 59.740 | WP_023352924 |
reverse transcriptase-like protein [Anaerostipes hadrus] RNase H [Lachnospiraceae bacterium TF10-8AT] Ribonuclease H [Anaerostipes hadrus] Ribonuclease H [Anaerostipes hadrus] |
8.41e-23 | 17 | 59.740 | WP_044923875 |
reverse transcriptase-like protein [Anaerostipes hadrus] RNase H [Anaerostipes hadrus] ribonuclease HI [Anaerostipes hadrus DSM 3319] Ribonuclease H [Anaerostipes hadrus] RNase H [Anaerostipes hadrus] |
8.49e-23 | 17 | 59.740 | WP_009203348 |
reverse transcriptase-like protein [Anaerostipes hadrus] RNase H [Lachnospiraceae bacterium AM23-7LB] RNase H [Lachnospiraceae bacterium AM25-27] RNase H [Lachnospiraceae bacterium OM02-26] Ribonuclease H [Anaerostipes hadrus] |
8.75e-23 | 17 | 59.740 | WP_055159317 |
predicted double-stranded RNA/RNA-DNA hybrid binding protein [Lachnospiraceae bacterium CAG:25] |
9.02e-23 | 17 | 59.740 | CDA33250 |
reverse transcriptase-like protein [Clostridium sp. SS2/1] ribonuclease HI [Clostridium sp. SS2/1] Predicted double-stranded RNA/RNA-DNA hybrid binding protein [Anaerostipes hadrus] |
9.58e-23 | 17 | 59.740 | WP_008391088 |
RNase H [Lachnospiraceae bacterium] |
1.12e-22 | 17 | 59.740 | HBI62233 |
RNase H [Hungatella hathewayi] |
1.29e-22 | 17 | 59.740 | RGC81676 |
reverse transcriptase-like protein [Lachnospiraceae bacterium oral taxon 096] RNase H [Lachnospiraceae bacterium oral taxon 096] |
1.37e-22 | 17 | 59.740 | WP_107626845 |
RNase H, partial [Lachnospiraceae bacterium] |
1.44e-22 | 17 | 57.143 | RKW43738 |
hypothetical protein [Photobacterium leiognathi] hypothetical protein C0W80_04660 [Photobacterium leiognathi subsp. mandapamensis] |
1.67e-22 | 69 | 29.154 | WP_107233774 |
reverse transcriptase-like protein [Lachnospiraceae bacterium AM10-38] RNase H [Lachnospiraceae bacterium AM10-38] |
1.82e-22 | 17 | 59.740 | WP_118471274 |
ribonuclease HI [Clostridium sp. CAG:253] |
2.85e-22 | 17 | 54.545 | CDB89208 |
RNase H [Blautia sp.] |
3.35e-22 | 17 | 57.143 | HCL10304 |
RNase H [Clostridiales bacterium] |
3.71e-22 | 17 | 55.844 | PWM52432 |
hypothetical protein [Flavobacterium branchiophilum] hypothetical protein B0A77_15215 [Flavobacterium branchiophilum] |
4.73e-22 | 70 | 27.273 | WP_097554989 |
RNase H [Clostridium sp. 42_12] |
5.08e-22 | 17 | 55.844 | OKZ62516 |
MULTISPECIES: reverse transcriptase-like protein [unclassified Clostridium] ribonuclease HI [Clostridium sp. CAG:75] RNase H [Lachnospiraceae bacterium] RNase H [Clostridium sp. AM49-4BH] RNase H [Clostridium sp. OM05-9BH] RNase H [Clostridium sp. OM05-6BH] |
6.66e-22 | 17 | 55.844 | WP_022025701 |
reverse transcriptase-like protein [Lachnospiraceae bacterium] |
7.1e-22 | 17 | 58.442 | RKW47093 |
reverse transcriptase-like protein [Lachnospiraceae bacterium oral taxon 500] hypothetical protein HMPREF0491_01899 [Lachnospiraceae oral taxon 107 str. F0167] |
7.1e-22 | 17 | 58.442 | WP_009220162 |
hypothetical protein [Grimontia marina] mRNA endoribonuclease LsoA [Grimontia marina] |
7.79e-22 | 65 | 26.621 | WP_062714882 |
ribonuclease HI [Firmicutes bacterium CAG:95] |
8.6e-22 | 17 | 57.143 | CDF06341 |
RNase H [Lachnospiraceae bacterium] |
9.51e-22 | 17 | 57.143 | HCG87312 |
reverse transcriptase-like protein [Peptostreptococcus sp. MV1] hypothetical protein HMPREF1639_05325 [Peptostreptococcus sp. MV1] |
1.34e-21 | 17 | 61.538 | WP_036764116 |
Ribonuclease H [uncultured Clostridium sp.] |
1.63e-21 | 17 | 54.545 | SCG89903 |
reverse transcriptase-like protein [Lachnospiraceae bacterium AM21-21] RNase H [Lachnospiraceae bacterium AM21-21] |
1.68e-21 | 17 | 58.442 | WP_118303441 |
reverse transcriptase-like protein [Lachnoanaerobaculum sp. OBRC5-5] hypothetical protein HMPREF1135_01340 [Lachnoanaerobaculum sp. OBRC5-5] |
1.86e-21 | 17 | 57.143 | WP_007593459 |
reverse transcriptase-like protein [Lachnoanaerobaculum sp. ICM7] caulimovirus viroplasmin / ribonuclease HI multi-domain protein [Lachnoanaerobaculum sp. ICM7] |
2.29e-21 | 17 | 57.143 | WP_009663013 |
reverse transcriptase-like protein [Eubacterium ventriosum] RNase H [Eubacterium ventriosum] RNase H [Eubacterium ventriosum] RNase H [Eubacterium ventriosum] |
2.37e-21 | 17 | 59.740 | WP_117969816 |
RNase H [Lachnospiraceae bacterium] |
2.49e-21 | 17 | 57.692 | HBZ63519 |
reverse transcriptase-like protein [Eubacterium ventriosum] RNase H [Eubacterium ventriosum] |
2.54e-21 | 17 | 59.740 | WP_117901318 |
reverse transcriptase-like protein [Eubacterium ventriosum] ribonuclease HI [Eubacterium ventriosum ATCC 27560] RNase H [Eubacterium ventriosum] |
2.57e-21 | 17 | 59.740 | WP_005359866 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_203 In lacto CP039121.1
Seq (len = 43 ):
VSVAHSQLTHASVLEQPSWQIEKHPVQLGKTHPFAGSSLRQLQ
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|143836|1|2722330-2722492
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.751209622424614
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_204 In ery NZ_CP036346.1
Seq (len = 39 ):
LEECTDQSKPVLQLMLDIQSCQVLHQTIMIYGHNKDRAN
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|357980|-1|1170483-1170615
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7103367392218034
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 25 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_205 In ery NZ_CP036346.1
Seq (len = 66 ):
MPGPTIIGSLLKYFLIELVNEYIILGTTEAIIMSSISSTNMLDACKKLSSINPYSSEVRSNFVVRR
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|327350|-1|1654772-1655048
Transkriptom
92.0% of gene length expressed over median expression of contig.
ŝ
1.9620425796437397
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_206 In ecoli U00096.3
Seq (len = 34 ):
IDNGCTVIRQRVEERCEWLAKGKLHRMFVGSINL
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|58159|1|1561956-1562067
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8397316045904502
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_207 In ecoli U00096.3
Seq (len = 25 ):
AADPSAAYAQWHRQHSDHPAKHPKS
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|204513|-1|3637822-3637897
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.1084625423274352
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_208 In ecoli U00096.3
Seq (len = 51 ):
MCLSLAKHRVRRKCQNSTLLHTRTDSHFFSPPKCRPDGGRKGRLQVRQIRR
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|184605|-1|4200113-4200278
Transkriptom
83.0% of gene length expressed over median expression of contig.
ŝ
1.7695510786217257
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_209 In ecoli U00096.3
Seq (len = 49 ):
IHFFYQPVTNQLAFEDVVGSDGGHIERFVFHINGTIEQEYRDFGIFRLF
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|175878|-1|4450252-4450522
Transkriptom
73.0% of gene length expressed over median expression of contig.
ŝ
2.033545374969405
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 4 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_210 In ecoli U00096.3
Seq (len = 33 ):
FASSNTTGTAVTTTGKSCQTSCQRAWDTPPASQ
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|164014|1|4512762-4512861
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9098595623657877
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Escherichia coli] |
1.51e-22 | 100 | 87.755 | STI83140 |
Uncharacterised protein [Klebsiella pneumoniae] |
1.76e-13 | 94 | 67.391 | VAU68734 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_211 In ecoli U00096.3
Seq (len = 158 ):
MTVKQIIFISTLTTYFGIEVQTTGGETACFENFIHHQRILFHTVRELVGVPAQLRIATVGVDRTEQAKRNGGGYFMMERVTCQRRVVSFNVQFNLFFQTKLFQEAIDRRGIVIILMFGRFLRFRFDKQRALETDFMFMLNHHLHKAAQLFTLLTQVGI
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|135277|1|3729556-3730171
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.645891560852599
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 61 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_212 In blautia CP039126.1
Seq (len = 27 ):
APVILQLLMTKQRRTGQLVYCRKSCRM
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|292285|-1|4450485-4450566
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.3288271572849166
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Shigella sonnei] |
2.3e-107 | 100 | 98.734 | CSP85998 |
Uncharacterised protein [Klebsiella pneumoniae] |
6.22e-47 | 80 | 55.906 | VAS31774 |
Uncharacterised protein [Klebsiella pneumoniae] |
8.11e-47 | 53 | 93.976 | SWG15001 |
Uncharacterised protein [Klebsiella pneumoniae] |
1.65e-46 | 80 | 55.906 | VAS63450 |
hypothetical protein BV349_05483 [Pseudomonas syringae pv. actinidiae] hypothetical protein BV351_05504 [Pseudomonas syringae pv. actinidiae] |
1.63e-33 | 100 | 45.570 | OSN58678 |
hypothetical protein ALP64_203743 [Pseudomonas syringae pv. actinidiae] |
3.33e-33 | 98 | 45.806 | RMS49307 |
Uncharacterised protein [Klebsiella pneumoniae] |
6.2e-32 | 53 | 69.880 | SSK75150 |
hypothetical protein ALP75_200770 [Pseudomonas syringae pv. actinidiae] |
3.84e-27 | 85 | 47.015 | RMS04073 |
Uncharacterised protein [Klebsiella aerogenes] |
4.05e-27 | 46 | 67.123 | VEC48177 |
Uncharacterised protein [Klebsiella pneumoniae] |
2.59e-22 | 53 | 60.241 | SSK82040 |
Uncharacterised protein [Mycobacterium tuberculosis] |
1.76e-20 | 27 | 100.000 | CNZ35568 |
hypothetical protein BJP26_13020 [Sphingomonas melonis TY] |
5.99e-20 | 98 | 34.839 | AOW24381 |
Uncharacterised protein [Shigella sonnei] |
3.2e-19 | 27 | 95.349 | CSG68223 |
hypothetical protein SB00610_03306 [Klebsiella quasipneumoniae subsp. similipneumoniae] |
3.91e-19 | 53 | 61.446 | VGP67937 |
Uncharacterised protein [Serratia odorifera] |
1.48e-15 | 38 | 55.000 | VDZ55675 |
hypothetical protein BvRS1_27330 [Burkholderia vietnamiensis] |
5.43e-15 | 100 | 39.241 | GBH25684 |
conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] |
9.03e-08 | 46 | 34.247 | EAU65515 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_213 In blautia CP039126.1
Seq (len = 16 ):
CGERKRQDLCICPQRI
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|273074|-1|4954648-4954696
Transkriptom
86.0% of gene length expressed over median expression of contig.
ŝ
1.6910800444771081
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_214 In blautia CP039126.1
Seq (len = 70 ):
ISSIICHTSGGLQTAPVRGSIKAACFSSLASPCTAASTASFCTQMDCEHTAAQPRGRSPTFGTLIPFPST
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|215812|1|6067650-6067869
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.4899020248116575
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) > 3}
Candidate nov_psm6_215 In blautia CP039126.1
Seq (len = 48 ):
MSVFKSYLRRLLQDLKDLKEAIKSKEYDKAENMVDKLIDDTQKGIEDD
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|144919|1|3908784-3908976
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.885822859755551
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_216 In blautia CP039126.1
Seq (len = 71 ):
ITRCFCWTHLRRYFVDALPKDANSPQATIPAQAVRYINRLFELEKKLEVLSPEGRKAQRLIQEKPVLDAVL
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|124082|1|3256361-3256784
Transkriptom
94.0% of gene length expressed over median expression of contig.
ŝ
3.601134483291174
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
IS66 family transposase, partial [Clostridiales bacterium VE202-06]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein CLOSTHATH_01231 [[Clostridium] hathewayi DSM 13479] [Hungatella hathewayi DSM 13479] |
4.48e-40 | 97 | 89.855 | EFD00581 |
IS66 family transposase, partial [Clostridiales bacterium VE202-06] |
2.6e-39 | 97 | 98.551 | WP_029471670 |
MULTISPECIES: IS66 family transposase [Clostridiales] IS66 family transposase [[Clostridium] symbiosum] IS66 family transposase [Hungatella hathewayi] |
2.7e-35 | 97 | 88.406 | WP_118020962 |
IS66 family transposase [Lachnospiraceae bacterium] |
2.03e-33 | 97 | 85.507 | WP_158418562 |
transposase IS66 family protein [Clostridium sp. FS41] Transposase IS66 family protein [[Clostridium] citroniae] |
3.21e-31 | 97 | 75.362 | KJJ68781 |
IS66 family transposase [[Desulfotomaculum] guttoideum] Transposase [[Desulfotomaculum] guttoideum] Transposase [[Desulfotomaculum] guttoideum] |
5.28e-31 | 97 | 79.710 | WP_092241064 |
IS66 family transposase [[Desulfotomaculum] guttoideum] Transposase [[Desulfotomaculum] guttoideum] Transposase [[Desulfotomaculum] guttoideum] |
5.33e-31 | 97 | 79.710 | WP_092242818 |
IS66 family transposase [Clostridium transplantifaecale] |
5.61e-31 | 97 | 81.159 | WP_125142464 |
IS66 family transposase [Clostridium transplantifaecale] |
5.91e-31 | 97 | 81.159 | WP_125142495 |
IS66 family transposase [Clostridium transplantifaecale] |
5.91e-31 | 97 | 81.159 | WP_125141119 |
IS66 family transposase [Clostridium transplantifaecale] |
5.91e-31 | 97 | 81.159 | WP_125140621 |
IS66 family transposase [[Clostridium] citroniae] hypothetical protein HMPREF9469_05983 [ [[Clostridium] citroniae WAL-17108] |
7.29e-30 | 97 | 78.261 | WP_007871487 |
putative uncharacterized protein [Clostridium sp. CAG:411] |
3.01e-29 | 97 | 76.812 | CDE46141 |
IS66 family transposase [Candidatus Galacturonibacter soehngenii] IS66 family transposase [Candidatus Galacturonibacter soehngenii] |
1.21e-27 | 97 | 73.913 | WP_151145618 |
IS66 family element, transposase [[Clostridium] scindens ATCC 35704] hypothetical protein HDCHBGLK_01698 [[Clostridium] scindens ATCC 35704] |
4.66e-27 | 97 | 78.261 | EDS05194 |
transposase IS66 family protein [Sporomusa silvacetica DSM 10669] |
1.27e-26 | 100 | 69.014 | OZC19883 |
hypothetical protein HMPREF0993_03195 [Lachnospiraceae bacterium 5_1_57FAA] |
1.28e-26 | 97 | 76.812 | EGN33362 |
IS66 family transposase, partial [Oxobacter pfennigii] |
2.79e-26 | 97 | 66.667 | WP_152967811 |
IS66 family transposase, partial [Pelosinus fermentans] transposase IS66, partial [Pelosinus fermentans A11] |
1.38e-25 | 97 | 72.464 | WP_007950254 |
IS66 family transposase [Pelosinus fermentans] transposase IS66 [Pelosinus fermentans DSM 17108] Transposase [Pelosinus fermentans] |
2.05e-25 | 97 | 72.464 | WP_064448912 |
transposase [[Clostridium] aerotolerans] |
3.13e-25 | 79 | 76.786 | WP_026892701 |
MULTISPECIES: IS66 family transposase [Pelosinus] transposase IS66 [Pelosinus fermentans B4] |
9.41e-25 | 97 | 71.014 | WP_007936744 |
IS66 family transposase [Pelosinus fermentans] transposase IS66 [Pelosinus fermentans DSM 17108] Transposase [Pelosinus fermentans] |
9.51e-25 | 97 | 71.014 | WP_064448913 |
Transposase IS66 family protein [Pelotomaculum sp. PtaB.Bin104] |
2.05e-24 | 97 | 69.565 | OPX86970 |
Transposase IS66 family protein [Lutispora thermophila DSM 19022] |
2.18e-24 | 93 | 68.182 | SHJ42198 |
transposase IS66 family [Sporomusa ovata DSM 2662] Mobile element protein [Sporomusa sp. An4] |
5.18e-24 | 97 | 63.768 | EQB28409 |
MULTISPECIES: IS66 family transposase, partial [Paenibacillus] IS66 family transposase [Paenibacillus validus] |
1.4e-23 | 97 | 63.768 | WP_141336819 |
IS66-like element ISCth11 family transposase [Hungateiclostridium thermocellum] transposase IS66 [Hungateiclostridium thermocellum ATCC 27405] IS66 family transposase ISCth11 [Hungateiclostridium thermocellum] |
1.81e-23 | 97 | 65.217 | WP_011837850 |
IS66 family transposase, partial [Paenibacillus validus] |
2.2e-23 | 97 | 63.768 | WP_127610822 |
IS66 family transposase [Clostridium tyrobutyricum] |
8.59e-23 | 97 | 63.768 | WP_058953309 |
IS66 family transposase [Clostridiales bacterium] |
1.05e-22 | 97 | 65.217 | HCS74668 |
IS66 family transposase [Brevibacillus parabrevis] transposase [Brevibacillus parabrevis] |
1.61e-22 | 97 | 65.217 | WP_063231252 |
transposase [Tissierella sp. P1] hypothetical protein CIW83_05560 [Tissierella sp. P1] |
2.41e-22 | 97 | 59.420 | WP_094899876 |
IS66 family transposase [Brevibacillus panacihumi] transposase IS66 [Brevibacillus panacihumi W25] transposase IS66 [Brevibacillus panacihumi W25] transposase IS66 [Brevibacillus panacihumi W25] |
2.42e-22 | 97 | 65.217 | WP_023554886 |
IS66 family transposase, partial [Acidaminobacter hydrogenoformans] IS66 C-terminal element, partial [Acidaminobacter hydrogenoformans DSM 2784] IS66 C-terminal element, partial [Acidaminobacter hydrogenoformans DSM 2784] |
1.51e-21 | 97 | 56.522 | WP_139159846 |
IS66 family transposase [Clostridium formicaceticum] hypothetical protein BJL90_13470 [Clostridium formicaceticum] Transposase IS66 family protein [Clostridium formicaceticum] |
2.26e-21 | 97 | 63.768 | WP_070968945 |
hypothetical transposase [Clostridium ljungdahlii DSM 13528] transposase IS66 [Clostridium autoethanogenum DSM 10061] Transposase IS66 [Clostridium autoethanogenum DSM 10061] |
2.64e-21 | 97 | 59.420 | ADK14044 |
IS66 family transposase [Tissierella sp. DSM 105185] |
3e-21 | 97 | 60.870 | WP_154440092 |
IS66 family transposase [Tissierella sp. DSM 105185] |
3.84e-21 | 97 | 60.870 | MSU01616 |
Transposase IS66 family protein [Clostridium autoethanogenum] |
4.79e-21 | 97 | 59.420 | OVY50330 |
IS66 family transposase, partial [bacterium 0.1xD8-82] IS66 family transposase, partial [bacterium 0.1xD8-82] |
9.47e-21 | 97 | 57.971 | WP_120472573 |
Transposase IS66 family protein [Clostridium ljungdahlii DSM 13528] |
1.03e-20 | 97 | 59.420 | OAA89238 |
IS66 family transposase [Peptostreptococcus russellii] transposase [Peptostreptococcus russellii] |
1.38e-20 | 97 | 59.420 | WP_106776176 |
IS66 family transposase, partial [Clostridium ljungdahlii] |
1.66e-20 | 97 | 59.420 | WP_156496161 |
hypothetical protein HMPREF9471_05194, partial [[Clostridium] clostridioforme WAL-7855] |
2.06e-20 | 97 | 56.522 | KMW27075 |
IS66 family transposase [Clostridium coskatii] Transposase IS66 family protein [Clostridium coskatii] transposase IS66 family protein [Clostridium coskatii] |
2.22e-20 | 97 | 60.870 | WP_063602071 |
Transposase IS66 family protein, partial [[Clostridium] clostridioforme] Transposase IS66 family protein, partial [[Clostridium] clostridioforme] |
2.77e-20 | 97 | 56.522 | SEU23564 |
IS66 family transposase [Tissierella creatinophila] |
3.01e-20 | 97 | 59.420 | WP_084191966 |
transposase IS66 family protein [Tissierella creatinophila DSM 6911] |
3.08e-20 | 97 | 59.420 | OLS01612 |
IS66-like element ISDeal1 family transposase [Dethiobacter alkaliphilus] transposase IS66 [Dethiobacter alkaliphilus AHT 1] |
3.31e-20 | 97 | 57.971 | WP_008516471 |
IS66 family transposase [Ruminococcaceae bacterium] |
3.35e-20 | 97 | 57.971 | WP_148462458 |
IS66 family transposase [Desulfitobacterium dichloroeliminans] transposase [Desulfitobacterium dichloroeliminans LMG P-21439] transposase [Desulfitobacterium dichloroeliminans LMG P-21439] |
3.96e-20 | 97 | 60.870 | WP_015261244 |
IS66 family transposase, partial [Clostridium autoethanogenum] |
4.06e-20 | 97 | 59.420 | WP_029170150 |
IS66 family transposase [Dethiobacter alkaliphilus] transposase IS66 [Dethiobacter alkaliphilus AHT 1] |
4.24e-20 | 97 | 57.971 | WP_008514365 |
hypothetical protein C819_02987 [Lachnospiraceae bacterium 10-1] |
4.29e-20 | 97 | 57.971 | EOS74683 |
Transposase IS66 family protein, partial [[Clostridium] clostridioforme] |
6.37e-20 | 97 | 56.522 | SFH19312 |
MULTISPECIES: IS66 family transposase, partial [unclassified Bacteria (miscellaneous)] IS66 family transposase, partial [bacterium D16-54] IS66 family transposase, partial [bacterium D16-56] |
7.38e-20 | 97 | 59.420 | WP_120425595 |
hypothetical protein HMPREF9467_04516 [ [[Clostridium] clostridioforme 2_1_49FAA] hypothetical protein Ccl03g_17130 [[Clostridium] clostridioforme] |
7.71e-20 | 97 | 56.522 | EHG27425 |
hypothetical protein HMPREF1083_00275, partial [[Clostridium] clostridioforme 90A6] |
7.76e-20 | 97 | 56.522 | ENZ68879 |
IS66 family transposase [Desulfitobacterium dichloroeliminans] transposase [Desulfitobacterium dichloroeliminans LMG P-21439] transposase [Desulfitobacterium dichloroeliminans LMG P-21439] |
1.04e-19 | 97 | 59.420 | WP_015262051 |
IS66 family transposase [Desulfitobacterium dichloroeliminans] transposase [Desulfitobacterium dichloroeliminans LMG P-21439] |
1.09e-19 | 97 | 59.420 | WP_015263253 |
IS66 family transposase [Clostridium ljungdahlii] predicted transposase [Clostridium ljungdahlii DSM 13528] |
1.13e-19 | 97 | 59.420 | WP_013237220 |
IS66 family transposase [Clostridium autoethanogenum] Transposase C of IS166 homeodomain [Clostridium autoethanogenum DSM 10061] |
1.21e-19 | 97 | 59.420 | WP_058893783 |
transposase [Clostridium kluyveri] |
1.3e-19 | 99 | 54.286 | WP_081427998 |
IS66 family transposase, partial [Clostridium sp. C105KSO14] |
1.7e-19 | 97 | 59.420 | WP_089774921 |
IS66 family transposase [[Clostridium] clostridioforme] |
1.74e-19 | 97 | 59.420 | WP_138263070 |
IS66 family transposase [[Clostridium] clostridioforme] transposase IS66 [[Clostridium] clostridioforme] |
1.77e-19 | 97 | 59.420 | WP_057571581 |
IS66 family transposase [[Clostridium] clostridioforme] transposase IS66 [[Clostridium] clostridioforme] |
1.8e-19 | 97 | 59.420 | WP_112481437 |
IS66 family transposase [[Clostridium] clostridioforme] transposase IS66 [[Clostridium] clostridioforme] transposase IS66 [[Clostridium] clostridioforme] |
1.8e-19 | 97 | 59.420 | WP_112482318 |
IS66 family transposase [[Clostridium] clostridioforme] transposase IS66 [[Clostridium] clostridioforme] |
1.84e-19 | 97 | 59.420 | WP_112482090 |
IS66 family transposase [Hungatella hathewayi] IS66 family transposase [Hungatella hathewayi] |
1.86e-19 | 97 | 59.420 | WP_117624477 |
hypothetical protein HMPREF1081_03972 [[Clostridium] clostridioforme 90A4] |
1.87e-19 | 97 | 56.522 | ENZ62417 |
hypothetical protein HMPREF1090_01541 [[Clostridium] clostridioforme 90A8] |
1.87e-19 | 97 | 56.522 | ENZ17991 |
hypothetical protein HMPREF1098_05162 [[Clostridium] clostridioforme CM201] hypothetical protein HMPREF1086_01136 [[Clostridium] clostridioforme 90B1] hypothetical protein HMPREF1087_05329 [[Clostridium] clostridioforme 90A1] hypothetical protein HMPREF1088_02868 [[Clostridium] clostridioforme 90A3] hypothetical protein HMPREF1083_04805 [[Clostridium] clostridioforme 90A6] |
1.87e-19 | 97 | 56.522 | ENY83599 |
IS66 family transposase [Keratinibaculum paraultunense] transposase IS66 family protein [Keratinibaculum paraultunense] |
1.96e-19 | 97 | 55.072 | WP_158280025 |
transposase IS66 [[Clostridium] clostridioforme] |
2.53e-19 | 97 | 59.420 | SQB15202 |
MULTISPECIES: IS66 family transposase [Dehalobacter] transposase IS66 [Dehalobacter restrictus DSM 9455] transposase [Dehalobacter sp. TeCB1] IS66 family transposase [Dehalobacter restrictus] |
2.7e-19 | 97 | 59.420 | WP_019226744 |
IS66 family transposase [Desulfosporosinus youngiae] transposase [Desulfosporosinus youngiae DSM 17734] |
3.52e-19 | 97 | 59.420 | WP_007787146 |
IS66 family transposase [Paenibacillus sp. N2SHLJ1] IS66 family transposase [Paenibacillus sp. N2SHLJ1] |
3.95e-19 | 93 | 59.091 | WP_131015159 |
IS66 family transposase [[Clostridium] clostridioforme] transposase IS66 [[Clostridium] clostridioforme] |
4.38e-19 | 97 | 57.971 | WP_112483199 |
MULTISPECIES: IS66 family transposase, partial [unclassified Bacteria (miscellaneous)] IS66 family transposase, partial [bacterium D16-54] IS66 family transposase, partial [bacterium D16-56] |
4.44e-19 | 97 | 57.971 | WP_120425589 |
IS66 family transposase [Clostridium autoethanogenum] IS66 family transposase [Clostridium autoethanogenum] |
4.8e-19 | 97 | 57.971 | WP_122058726 |
IS66 family transposase [Clostridium ragsdalei] transposase IS66 family protein [Clostridium ragsdalei P11] |
4.89e-19 | 97 | 57.971 | WP_065077985 |
IS66 family transposase [Tissierella praeacuta] |
5e-19 | 97 | 57.971 | WP_132984509 |
transposase [Tissierella praeacuta] |
5.06e-19 | 97 | 57.971 | TCU64858 |
IS66 family transposase [Tissierella sp.] |
5.36e-19 | 97 | 57.971 | HAE91813 |
IS66 family transposase, partial [Acidaminobacter hydrogenoformans] Transposase, partial [Acidaminobacter hydrogenoformans DSM 2784] |
5.46e-19 | 97 | 55.072 | WP_092592519 |
IS66 family transposase [Clostridium sp. N3C] Transposase [Clostridium sp. N3C] |
6.35e-19 | 97 | 55.072 | WP_074366677 |
IS66 family transposase [Tissierella praeacuta] |
6.85e-19 | 97 | 57.971 | WP_115322228 |
Transposase and inactivated derivatives [Tissierella praeacuta] |
6.93e-19 | 97 | 57.971 | SUP02458 |
IS66 family transposase, partial [Paenibacillus rigui] IS66 family transposase, partial [Paenibacillus rigui] |
8.91e-19 | 93 | 59.091 | WP_094018853 |
IS66 family transposase [Lachnoclostridium sp. YL32] IS66 family transposase [Lachnoclostridium sp. YL32] |
1.02e-18 | 97 | 56.522 | WP_065550404 |
IS66 family transposase [Lachnoclostridium sp. YL32] IS66 family transposase [Lachnoclostridium sp. YL32] IS66 family transposase [Lachnoclostridium sp. YL32] |
1.03e-18 | 97 | 56.522 | WP_065548862 |
IS66 family transposase [[Clostridium] clostridioforme] IS66 family transposase [[Clostridium] clostridioforme] |
1.07e-18 | 97 | 56.522 | WP_094099428 |
IS66 family transposase [bacterium 0.1xD8-71] IS66 family transposase [bacterium 0.1xD8-71] |
1.14e-18 | 97 | 57.971 | WP_120413802 |
IS66 family transposase [Lachnoclostridium sp. YL32] IS66 family transposase [Lachnoclostridium sp. YL32] |
1.18e-18 | 97 | 56.522 | WP_065550732 |
MULTISPECIES: IS66 family transposase [Clostridiales] transposase IS66 [[Clostridium] clostridioforme] Transposase IS66 family protein [Clostridium sp. C105KSO14] |
1.19e-18 | 97 | 56.522 | WP_057572708 |
IS66 family transposase [Clostridium coskatii] Transposase IS66 family protein [Clostridium coskatii] transposase IS66 family protein [Clostridium coskatii] |
1.39e-18 | 96 | 57.353 | WP_063602533 |
IS66 family transposase [[Clostridium] clostridioforme] IS66 family transposase [[Clostridium] clostridioforme] |
2.44e-18 | 97 | 55.072 | WP_094099418 |
transposase IS66 family protein [Kineothrix alysoides] |
2.91e-18 | 79 | 67.857 | TCL58869 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_217 In blautia CP039126.1
Seq (len = 33 ):
YLPADSPVRHRSPPMWKNVWPLLCLSSGWTGLH
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|117229|1|3075605-3075704
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7704888038463675
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_218 In bifi AE014295.3
Seq (len = 374 ):
MQSHLQIAGHGDDLAHRTRLEGFGHGPRRAHLRRIGTSLYFIAIGQCENLPALDILHHGDRPRCTILGFGLLQDLFDIPLHITVNGQGDIVAIFGRHRFGHGAGNLFAAITTLVGFMAIGSGKRLVLDLLDAGDAIAVVVHAAKQRAHEIAIRIQSFTAQLTPDNTAQVQRLDAALDLRSHIFLQNHILPGTGQISAQFHGVHIQDFGQQSAHGRRSGSAHGFAVNFVAVITGVVIASNRLELLCSLRIGDDSITLHALSEHGAVGVEDTPTFGAQRHGQGAVSRGRLCGLTAADELGGGQLNHACRRHQRQCGADGDAFEREGLDLGELYDATNGVHWVPPLLDWYPLKSMDTDPCCGTMPMSLALSGRFATN
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|96469|-1|194295-195480
Transkriptom
63.0% of gene length expressed over median expression of contig.
ŝ
2.4621809049267256
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_219 In bifi AE014295.3
Seq (len = 428 ):
VAGLVREWYRVAATLEADGRQVDGHLALLADDLAVLLVVASVAAVLAGVQADAVRATVLSDDDEAHDGAVLGLVFEAVQVAVLDLAEGDGGHAVLERVGFRRRKGDGLMGRGNAHGQGCCDADGCDKAPHGSGDGVAAEYLMPAQRGLVGSRHIMGFHTETGHDGGHGGNQEHQRLRHNHRGVLVDGPSQRHEHRMVHREASRLQNLGKTSEVLNQQNHHHGRDGHGERPAHGSGAHRAEDGGHNNGHGHAKQETKSAQQHGRSECGLPWFHPDGELQNHVRQRVEQGECDVDGGHGVSDVHEHLVLLPIGGDAACEHHHDDGQDVGNDRAPQHRVVDERALIDHGRGAQAGEYDGGDQTDDQADETPMRAYRLISPLADREHHAQAHHQQCGGQSARHHCHELFKHSRPFSVHLRLPSLRGAVREAD
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|30839|1|1405319-1407257
Transkriptom
1.0% of gene length expressed over median expression of contig.
ŝ
1.7904849854573688
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Bifidobacterium catenulatum] |
1.49e-47 | 64 | 37.319 | VUX31197 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_220 In bifi AE014295.3
Seq (len = 131 ):
MWVWIWVVGLTAECTRRKAGTAQSRYLTCQSDLRSGSFSRRAASSIWMTLIPAASRSSTSSRMARASCLVCSSWVMSSRGQDQLRMVTGPVSMPFITWSVLDWAYADHSTVIGLARETSPQTIGGLTQRVP
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|12318|1|580071-580467
Transkriptom
41.0% of gene length expressed over median expression of contig.
ŝ
1.5233615629864337
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] |
8.63e-12 | 76 | 52.000 | COY86625 |
Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] Uncharacterised protein [Mycobacterium tuberculosis] |
4.03e-08 | 70 | 52.174 | CFS02772 |
Uncharacterised protein [Klebsiella pneumoniae] |
8.21e-08 | 35 | 63.043 | STT00580 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_221 In bact CP040530.1
Seq (len = 20 ):
MIYCLIFKIKGLIHERTSLM
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|492189|-1|757131-757197
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.2577987463003253
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_222 In anaero CP036345.1
Seq (len = 25 ):
TSWWATHWKVMTTTEFRFTSEMRRR
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|198951|-1|2058319-2058394
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.8659291938512281
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 7 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_223 In anaero CP036345.1
Seq (len = 13 ):
MIQDKEAPKAIKQ
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|112732|1|2926930-2927140
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7928146086480308
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_224 In lacto CP039121.1
Seq (len = 22 ):
CTINKYITMQVLGLLIGTGAVC
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|42884|1|768300-768366
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.6096537668606108
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_225 In lacto CP039121.1
Seq (len = 31 ):
ILLIDFTLTRLKSSRLYFSFNTRFETGARFF
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|332613|-1|110914-111025
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.3575354797578785
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_226 In lacto CP039121.1
Seq (len = 42 ):
ICACACRKYGTGGAGNWVSLDSTRGLSGSRGYAGTVDCLYRH
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|222969|-1|2262289-2262433
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.074344185109315
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_227 In ery NZ_CP036346.1
Seq (len = 38 ):
LFCFHHLCRCDNNFHFNHQDYYIVFQQNMIYLTVVMKE
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|66643|1|953497-953635
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8996294548824368
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_228 In ery NZ_CP036346.1
Seq (len = 44 ):
MVFSQVMDSIVLIMKWLFMKNILKEKILEIYYHILTKIRFPYYL
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|46365|1|666604-666757
Transkriptom
59.0% of gene length expressed over median expression of contig.
ŝ
1.9162585599921975
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_229 In ery NZ_CP036346.1
Seq (len = 13 ):
LAVDFLNDSKSHY
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|394474|-1|594842-594974
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.8973376581028523
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_230 In ery NZ_CP036346.1
Seq (len = 38 ):
MPHTLFFSSPITYPIKYILTKINDSSNNSRDYFNQTFS
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|378220|-1|850360-850504
Transkriptom
92.0% of gene length expressed over median expression of contig.
ŝ
1.624641261082806
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{no overlap with annotation}
Candidate nov_psm6_231 In ery NZ_CP036346.1
Seq (len = 31 ):
MKKIIKPIQPIKPSPPTKNKPKNSSIKKPSK
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|124096|1|1794124-1794268
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
3.2106543592794208
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_232 In ecoli U00096.3
Seq (len = 40 ):
MRRTGGTETSKYPEEKKSTEIPPVAASERGGAQSLNQCVC
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|8160|1|225918-226050
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0008694587126286
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_233 In ecoli U00096.3
Seq (len = 64 ):
MAIPCAAISGVCSAGFASTLLPAASAAAICPVKIASGKFHGLIHTTGPNGRWVSLAKSSRTCPA
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|39458|1|1076264-1076624
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.5627780976002215
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein TI10_22600 [Photorhabdus luminescens subsp. luminescens] |
4.19e-15 | 93 | 91.892 | KMW71019 |
hypothetical protein AZ041_000210, partial [Escherichia coli] |
1.19e-11 | 75 | 100.000 | OUG02203 |
hypothetical protein VIS19158_20082 [Vibrio scophthalmi LMG 19158] |
1.64e-09 | 80 | 90.625 | EGU43538 |
hypothetical protein, partial [uncultured bacterium] |
8.09e-09 | 65 | 100.000 | AMP56217 |
hypothetical protein FD156_1167 [Nitrospirae bacterium] |
1.75e-07 | 85 | 73.529 | KAF0145056 |
hypothetical protein GZ78_03370 [Endozoicomonas numazuensis] |
4.37e-07 | 78 | 87.097 | KEQ19074 |
hypothetical protein A2569_01525 [Candidatus Vogelbacteria bacterium RIFOXYD1_FULL_51_18] |
7.71e-07 | 88 | 68.571 | OHA60222 |
conserved hypothetical protein [Vibrio nigripulchritudo AM115] |
9.55e-07 | 88 | 74.286 | CCN38115 |
hypothetical protein Gain_0022_001 [Komagataeibacter intermedius TF2] |
1.13e-06 | 88 | 74.286 | GAN86214 |
hypothetical protein Gxy13693_039_001 [Komagataeibacter xylinus NBRC 13693] |
3.89e-06 | 83 | 75.758 | GAO00054 |
hypothetical protein Geu3261_0022_002 [Komagataeibacter europaeus NBRC 3261] |
3.98e-06 | 83 | 75.758 | GAN95438 |
hypothetical protein A2Y26_03040 [candidate division CPR2 bacterium GWD2_39_7] |
5.48e-06 | 80 | 75.000 | OGB73125 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_234 In ecoli U00096.3
Seq (len = 37 ):
PSSFGNGLFGARSRIKVSDFSFASSAFIEVFSTSSPC
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|333449|-1|143407-143518
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.137868620686963
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 4 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ochrobactrum intermedium 229E]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104] |
2.38e-23 | 95 | 83.607 | CQC06620 |
Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] |
3.25e-23 | 95 | 83.607 | CFW71713 |
Uncharacterised protein [Bordetella pertussis] Uncharacterised protein [Bordetella pertussis] Uncharacterised protein [Bordetella pertussis] Uncharacterised protein [Bordetella pertussis] Uncharacterised protein [Bordetella pertussis] |
1.59e-18 | 91 | 72.414 | CFE03023 |
Uncharacterised protein [Bordetella trematum] |
3.53e-16 | 83 | 73.585 | SAI07272 |
bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ochrobactrum intermedium 229E] |
1.67e-12 | 77 | 76.000 | ERM02058 |
hypothetical protein X551_04776 [Methylibium sp. T29] |
1.49e-07 | 67 | 65.116 | EWS52440 |
hypothetical protein LT19_02076 [Pseudomonas aeruginosa] |
1.56e-07 | 70 | 60.000 | KYO90737 |
Uncharacterised protein [Mycobacteroides abscessus] |
2.79e-07 | 78 | 52.000 | CPV95804 |
Uncharacterised protein [Mycobacteroides abscessus] |
6.06e-07 | 78 | 50.000 | CPU01805 |
hypothetical protein PA66_05889 [Pseudomonas aeruginosa] Uncharacterised protein [Enterobacter cloacae] Uncharacterised protein [Acinetobacter baumannii] hypothetical protein PA92_05645 [Pseudomonas aeruginosa] hypothetical protein PA86_05747 [Pseudomonas aeruginosa] |
6.56e-07 | 70 | 60.000 | RCL91927 |
hypothetical protein LT17_06993 [Pseudomonas aeruginosa] hypothetical protein BN889_02159 [Pseudomonas aeruginosa PA38182] hypothetical protein PA64_05772 [Pseudomonas aeruginosa] hypothetical protein PA157_05776 [Pseudomonas aeruginosa] hypothetical protein PA82_05874 [Pseudomonas aeruginosa] |
7.23e-07 | 70 | 60.000 | KXG11695 |
hypothetical protein C3O68_05793 [Pseudomonas aeruginosa] Uncharacterised protein [Pseudomonas aeruginosa] |
7.31e-07 | 70 | 60.000 | RCM97919 |
hypothetical protein AW08_02731 [Candidatus Accumulibacter sp. SK-12] |
9.92e-07 | 83 | 57.407 | EXI65992 |
hypothetical protein KBTEX_04367 [uncultured organism] |
1.9e-06 | 70 | 55.556 | QEA07999 |
Uncharacterised protein [Acinetobacter baumannii] Uncharacterised protein [Acinetobacter baumannii] Uncharacterised protein [Acinetobacter baumannii] |
2e-06 | 73 | 52.083 | SSQ35361 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
2.07e-06 | 78 | 48.000 | SKU76427 |
Uncharacterised protein [Mycobacteroides abscessus subsp. massiliense] |
2.61e-06 | 67 | 58.140 | SKX48589 |
hypothetical protein AHiyo8_41830 [Arthrobacter sp. Hiyo8] |
4.63e-06 | 72 | 58.696 | BAS15880 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
6.15e-06 | 67 | 55.814 | SHY20634 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_235 In ecoli U00096.3
Seq (len = 45 ):
ICQHDALHYRRRCRFQTGNFHQHWACAQSCSIYGWYPATGVKYAG
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|259853|-1|2151882-2152017
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
3.0327641290636342
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_236 In ecoli U00096.3
Seq (len = 40 ):
MRRTGGTETSKYPEEKKSTEIPPVAASERGAAQSLNQCVC
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|238671|-1|2728892-2729024
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0008694587126286
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
phosphatase 2C family protein [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein CV83915_04213 [Escherichia coli] hypothetical protein ECG581_2474 [Escherichia coli G58-1] hypothetical protein G972_02253 [Escherichia coli UMEA 3355-1] protein [Escherichia coli] protein [Escherichia coli] |
3.28e-22 | 87 | 94.872 | ATZ34489 |
phosphatase 2C family protein [Escherichia coli] |
6.08e-20 | 84 | 97.368 | AWF22561 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_237 In ecoli U00096.3
Seq (len = 28 ):
IRQNHKTHLLIDVKEVKSRQLCSLACAK
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|229668|-1|2968412-2968511
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.77780395369828
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein TI10_22600 [Photorhabdus luminescens subsp. luminescens] |
1.84e-14 | 93 | 89.189 | KMW71019 |
hypothetical protein AZ041_000210, partial [Escherichia coli] |
9.07e-12 | 75 | 100.000 | OUG02203 |
hypothetical protein VIS19158_20082 [Vibrio scophthalmi LMG 19158] |
5.84e-10 | 80 | 90.625 | EGU43538 |
hypothetical protein, partial [uncultured bacterium] |
7.01e-09 | 65 | 100.000 | AMP56217 |
hypothetical protein FD156_1167 [Nitrospirae bacterium] |
1.32e-07 | 85 | 73.529 | KAF0145056 |
hypothetical protein GZ78_03370 [Endozoicomonas numazuensis] |
1.66e-07 | 78 | 87.097 | KEQ19074 |
conserved hypothetical protein [Vibrio nigripulchritudo AM115] |
4.4e-07 | 88 | 74.286 | CCN38115 |
hypothetical protein Gain_0022_001 [Komagataeibacter intermedius TF2] |
4.59e-07 | 88 | 74.286 | GAN86214 |
hypothetical protein Gxy13693_039_001 [Komagataeibacter xylinus NBRC 13693] |
1.55e-06 | 83 | 75.758 | GAO00054 |
hypothetical protein Geu3261_0022_002 [Komagataeibacter europaeus NBRC 3261] |
1.73e-06 | 83 | 75.758 | GAN95438 |
hypothetical protein A2Y26_03040 [candidate division CPR2 bacterium GWD2_39_7] |
2.28e-06 | 80 | 75.000 | OGB73125 |
hypothetical protein A2569_01525 [Candidatus Vogelbacteria bacterium RIFOXYD1_FULL_51_18] |
6.02e-06 | 88 | 65.714 | OHA60222 |
hypothetical protein PAEAM_48670 [Paenibacillus sp. GM1FR] |
6.38e-06 | 85 | 70.588 | PJN52042 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_238 In ecoli U00096.3
Seq (len = 40 ):
MRRTGGTETSKYPEEKKSTEIPPVAASERGAAQSLNQCVC
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|212431|-1|3426491-3426623
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0008694587126286
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_239 In ecoli U00096.3
Seq (len = 40 ):
MRRTGGTETSKYPEEKKSTEIPPVAASERGAAQSLNQCVC
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|152876|1|4210202-4210334
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0008694587126286
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein TI10_22600 [Photorhabdus luminescens subsp. luminescens] |
1.84e-14 | 93 | 89.189 | KMW71019 |
hypothetical protein AZ041_000210, partial [Escherichia coli] |
9.07e-12 | 75 | 100.000 | OUG02203 |
hypothetical protein VIS19158_20082 [Vibrio scophthalmi LMG 19158] |
5.84e-10 | 80 | 90.625 | EGU43538 |
hypothetical protein, partial [uncultured bacterium] |
7.01e-09 | 65 | 100.000 | AMP56217 |
hypothetical protein FD156_1167 [Nitrospirae bacterium] |
1.32e-07 | 85 | 73.529 | KAF0145056 |
hypothetical protein GZ78_03370 [Endozoicomonas numazuensis] |
1.66e-07 | 78 | 87.097 | KEQ19074 |
conserved hypothetical protein [Vibrio nigripulchritudo AM115] |
4.4e-07 | 88 | 74.286 | CCN38115 |
hypothetical protein Gain_0022_001 [Komagataeibacter intermedius TF2] |
4.59e-07 | 88 | 74.286 | GAN86214 |
hypothetical protein Gxy13693_039_001 [Komagataeibacter xylinus NBRC 13693] |
1.55e-06 | 83 | 75.758 | GAO00054 |
hypothetical protein Geu3261_0022_002 [Komagataeibacter europaeus NBRC 3261] |
1.73e-06 | 83 | 75.758 | GAN95438 |
hypothetical protein A2Y26_03040 [candidate division CPR2 bacterium GWD2_39_7] |
2.28e-06 | 80 | 75.000 | OGB73125 |
hypothetical protein A2569_01525 [Candidatus Vogelbacteria bacterium RIFOXYD1_FULL_51_18] |
6.02e-06 | 88 | 65.714 | OHA60222 |
hypothetical protein PAEAM_48670 [Paenibacillus sp. GM1FR] |
6.38e-06 | 85 | 70.588 | PJN52042 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_240 In ecoli U00096.3
Seq (len = 40 ):
MRRTGGTETSKYPEEKKSTEIPPVAASERGAAQSLNQCVC
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|151297|1|4168800-4168932
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0008694587126286
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein TI10_22600 [Photorhabdus luminescens subsp. luminescens] |
1.84e-14 | 93 | 89.189 | KMW71019 |
hypothetical protein AZ041_000210, partial [Escherichia coli] |
9.07e-12 | 75 | 100.000 | OUG02203 |
hypothetical protein VIS19158_20082 [Vibrio scophthalmi LMG 19158] |
5.84e-10 | 80 | 90.625 | EGU43538 |
hypothetical protein, partial [uncultured bacterium] |
7.01e-09 | 65 | 100.000 | AMP56217 |
hypothetical protein FD156_1167 [Nitrospirae bacterium] |
1.32e-07 | 85 | 73.529 | KAF0145056 |
hypothetical protein GZ78_03370 [Endozoicomonas numazuensis] |
1.66e-07 | 78 | 87.097 | KEQ19074 |
conserved hypothetical protein [Vibrio nigripulchritudo AM115] |
4.4e-07 | 88 | 74.286 | CCN38115 |
hypothetical protein Gain_0022_001 [Komagataeibacter intermedius TF2] |
4.59e-07 | 88 | 74.286 | GAN86214 |
hypothetical protein Gxy13693_039_001 [Komagataeibacter xylinus NBRC 13693] |
1.55e-06 | 83 | 75.758 | GAO00054 |
hypothetical protein Geu3261_0022_002 [Komagataeibacter europaeus NBRC 3261] |
1.73e-06 | 83 | 75.758 | GAN95438 |
hypothetical protein A2Y26_03040 [candidate division CPR2 bacterium GWD2_39_7] |
2.28e-06 | 80 | 75.000 | OGB73125 |
hypothetical protein A2569_01525 [Candidatus Vogelbacteria bacterium RIFOXYD1_FULL_51_18] |
6.02e-06 | 88 | 65.714 | OHA60222 |
hypothetical protein PAEAM_48670 [Paenibacillus sp. GM1FR] |
6.38e-06 | 85 | 70.588 | PJN52042 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_241 In ecoli U00096.3
Seq (len = 30 ):
RFYRRVAGCHARCAGGTCDLAQMLRSERDQ
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|14834|1|402246-402336
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.2575367285054075
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein TI10_22600 [Photorhabdus luminescens subsp. luminescens] |
1.84e-14 | 93 | 89.189 | KMW71019 |
hypothetical protein AZ041_000210, partial [Escherichia coli] |
9.07e-12 | 75 | 100.000 | OUG02203 |
hypothetical protein VIS19158_20082 [Vibrio scophthalmi LMG 19158] |
5.84e-10 | 80 | 90.625 | EGU43538 |
hypothetical protein, partial [uncultured bacterium] |
7.01e-09 | 65 | 100.000 | AMP56217 |
hypothetical protein FD156_1167 [Nitrospirae bacterium] |
1.32e-07 | 85 | 73.529 | KAF0145056 |
hypothetical protein GZ78_03370 [Endozoicomonas numazuensis] |
1.66e-07 | 78 | 87.097 | KEQ19074 |
conserved hypothetical protein [Vibrio nigripulchritudo AM115] |
4.4e-07 | 88 | 74.286 | CCN38115 |
hypothetical protein Gain_0022_001 [Komagataeibacter intermedius TF2] |
4.59e-07 | 88 | 74.286 | GAN86214 |
hypothetical protein Gxy13693_039_001 [Komagataeibacter xylinus NBRC 13693] |
1.55e-06 | 83 | 75.758 | GAO00054 |
hypothetical protein Geu3261_0022_002 [Komagataeibacter europaeus NBRC 3261] |
1.73e-06 | 83 | 75.758 | GAN95438 |
hypothetical protein A2Y26_03040 [candidate division CPR2 bacterium GWD2_39_7] |
2.28e-06 | 80 | 75.000 | OGB73125 |
hypothetical protein A2569_01525 [Candidatus Vogelbacteria bacterium RIFOXYD1_FULL_51_18] |
6.02e-06 | 88 | 65.714 | OHA60222 |
hypothetical protein PAEAM_48670 [Paenibacillus sp. GM1FR] |
6.38e-06 | 85 | 70.588 | PJN52042 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_242 In ecoli U00096.3
Seq (len = 40 ):
MRRTGGTETSKYPEEKKSTEIPPVAASERGAAQSLNQCVC
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|146543|1|4037678-4037810
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0008694587126286
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_243 In ecoli U00096.3
Seq (len = 40 ):
MRRTGGTETSKYPEEKKSTEIPPVAASERGAAQSLNQYVC
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|143264|1|3943863-3943995
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0008694587126286
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein TI10_22600 [Photorhabdus luminescens subsp. luminescens] |
1.84e-14 | 93 | 89.189 | KMW71019 |
hypothetical protein AZ041_000210, partial [Escherichia coli] |
9.07e-12 | 75 | 100.000 | OUG02203 |
hypothetical protein VIS19158_20082 [Vibrio scophthalmi LMG 19158] |
5.84e-10 | 80 | 90.625 | EGU43538 |
hypothetical protein, partial [uncultured bacterium] |
7.01e-09 | 65 | 100.000 | AMP56217 |
hypothetical protein FD156_1167 [Nitrospirae bacterium] |
1.32e-07 | 85 | 73.529 | KAF0145056 |
hypothetical protein GZ78_03370 [Endozoicomonas numazuensis] |
1.66e-07 | 78 | 87.097 | KEQ19074 |
conserved hypothetical protein [Vibrio nigripulchritudo AM115] |
4.4e-07 | 88 | 74.286 | CCN38115 |
hypothetical protein Gain_0022_001 [Komagataeibacter intermedius TF2] |
4.59e-07 | 88 | 74.286 | GAN86214 |
hypothetical protein Gxy13693_039_001 [Komagataeibacter xylinus NBRC 13693] |
1.55e-06 | 83 | 75.758 | GAO00054 |
hypothetical protein Geu3261_0022_002 [Komagataeibacter europaeus NBRC 3261] |
1.73e-06 | 83 | 75.758 | GAN95438 |
hypothetical protein A2Y26_03040 [candidate division CPR2 bacterium GWD2_39_7] |
2.28e-06 | 80 | 75.000 | OGB73125 |
hypothetical protein A2569_01525 [Candidatus Vogelbacteria bacterium RIFOXYD1_FULL_51_18] |
6.02e-06 | 88 | 65.714 | OHA60222 |
hypothetical protein PAEAM_48670 [Paenibacillus sp. GM1FR] |
6.38e-06 | 85 | 70.588 | PJN52042 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_244 In clostri CP040627.1
Seq (len = 23 ):
IGIDSIIKLMSSVNTFKISRENI
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040627.1|88187|-1|231268-231379
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.4408917106333679
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein TI10_22600 [Photorhabdus luminescens subsp. luminescens] |
2.61e-14 | 93 | 89.189 | KMW71019 |
hypothetical protein AZ041_000210, partial [Escherichia coli] |
1.28e-11 | 75 | 100.000 | OUG02203 |
hypothetical protein VIS19158_20082 [Vibrio scophthalmi LMG 19158] |
7.12e-10 | 80 | 90.625 | EGU43538 |
hypothetical protein, partial [uncultured bacterium] |
9.44e-09 | 65 | 100.000 | AMP56217 |
hypothetical protein GZ78_03370 [Endozoicomonas numazuensis] |
1.06e-07 | 93 | 78.378 | KEQ19074 |
hypothetical protein FD156_1167 [Nitrospirae bacterium] |
1.77e-07 | 85 | 73.529 | KAF0145056 |
conserved hypothetical protein [Vibrio nigripulchritudo AM115] |
5.24e-07 | 88 | 74.286 | CCN38115 |
hypothetical protein Gain_0022_001 [Komagataeibacter intermedius TF2] |
6.1e-07 | 88 | 74.286 | GAN86214 |
hypothetical protein Gxy13693_039_001 [Komagataeibacter xylinus NBRC 13693] |
1.75e-06 | 83 | 75.758 | GAO00054 |
hypothetical protein Geu3261_0022_002 [Komagataeibacter europaeus NBRC 3261] |
1.95e-06 | 83 | 75.758 | GAN95438 |
hypothetical protein A2Y26_03040 [candidate division CPR2 bacterium GWD2_39_7] |
3e-06 | 80 | 75.000 | OGB73125 |
hypothetical protein A2569_01525 [Candidatus Vogelbacteria bacterium RIFOXYD1_FULL_51_18] |
6.92e-06 | 88 | 65.714 | OHA60222 |
hypothetical protein PAEAM_48670 [Paenibacillus sp. GM1FR] |
7.93e-06 | 85 | 70.588 | PJN52042 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_245 In clostri CP040627.1
Seq (len = 42 ):
MWFPSKKSICTEILFRSFHKLYYKFFRSIIINHTYCIFFFNQ
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040627.1|31771|1|463463-463640
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.7463389790532733
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_246 In clostri CP040626.1
Seq (len = 68 ):
IFVCNLYLQNFNLLVKISSQTKNPTPPTTIKLIITKFTTMSPLYKVSDELGSNLPIKSKPALQNAEIE
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|508022|-1|313009-313261
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.7272304134482404
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_247 In clostri CP040626.1
Seq (len = 40 ):
IKYTFSANFVKNKASSSAAFPPPTTAIFFPSYIAPSHTAQ
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|251053|1|3741768-3741900
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.1095789811990855
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_248 In blautia CP039126.1
Seq (len = 48 ):
LLCGACVYRTGGTLLGSVCKRDHCGTYKRGEQISYHPCYPGISGLSGA
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|90479|1|2344855-2345065
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7259961831840787
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 18 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_249 In blautia CP039126.1
Seq (len = 25 ):
MPIRETTIRTIPKNIKTRCCPRALK
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|62390|1|1615077-1615155
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.5638373529592438
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Blautia producta] hypothetical protein EV205_14913 [Blautia coccoides] Uncharacterised protein [Blautia coccoides] |
4.28e-33 | 100 | 100.000 | WP_018597594 |
hypothetical protein [Eubacterium sp. ER2] |
5.7e-20 | 100 | 68.421 | WP_156111848 |
hypothetical protein [Sellimonas intestinalis] |
3.04e-15 | 98 | 55.357 | WP_156316915 |
hypothetical protein [Drancourtella sp. An57] |
2.08e-12 | 98 | 51.786 | WP_158099232 |
hypothetical protein [[Clostridium] populeti] hypothetical protein SAMN05661086_00138 [[Clostridium] populeti] |
2.24e-07 | 98 | 39.286 | WP_092558770 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_250 In blautia CP039126.1
Seq (len = 13 ):
LTVTIDSLKQGRI
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|56611|1|1468983-1469199
Transkriptom
87.0% of gene length expressed over median expression of contig.
ŝ
2.0139751179933127
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_251 In blautia CP039126.1
Seq (len = 88 ):
MWETVHPFPPVLSATASERPDDRHTPFPPGLRTVGYNLQPPHKNQKCRLSARKTALSYPKQILPAGIDAISYRFLSFSDSCSHQLLSA
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|414828|-1|1018342-1018639
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7976933581075434
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_252 In blautia CP039126.1
Seq (len = 37 ):
IAPAQKILLVHKDCILRFGEILHHDLQQIGRGLTLVR
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|403249|-1|1360828-1361134
Transkriptom
93.0% of gene length expressed over median expression of contig.
ŝ
2.090800680825616
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_253 In blautia CP039126.1
Seq (len = 38 ):
MILLYHLENTNKIKIDNRLQKELDRLQYSMFIRRYPYT
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|402704|-1|1376764-1376896
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.1815541547571833
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_254 In blautia CP039126.1
Seq (len = 18 ):
TASAPPKPQAPYPVWYRI
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|373428|-1|2267256-2267310
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.996683107541845
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_255 In blautia CP039126.1
Seq (len = 13 ):
LTVTIDSLKQGRI
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|306020|-1|4092301-4092517
Transkriptom
88.0% of gene length expressed over median expression of contig.
ŝ
2.0139751179933127
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_256 In blautia CP039126.1
Seq (len = 41 ):
FCPSVSVKKGTAVQAGQCALGRQGTQKSLHGACGCDGYAVC
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|304433|-1|4131641-4131764
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.5940278961439724
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is low}
Candidate nov_psm6_257 In blautia CP039126.1
Seq (len = 89 ):
MKNKEYLRLQLFAAPENTITTTDLEPAISVDFASRLSTNITELQNLLGIVDLDAMSEGTTIKMYKMTRVNTPAQVAEVKRLHLLKSSRS
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|302852|-1|4170992-4171262
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
4.085384678612923
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_258 In blautia CP039126.1
Seq (len = 48 ):
LLPYPKIIQNIIRSRYLKHLPKRLKTDTILNVYLPYITISERPIITFI
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|28974|1|758985-759129
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.9255492810454087
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_259 In blautia CP039126.1
Seq (len = 91 ):
MQVHLYHMYADRYDRGHCLPVGGKRCDIKHHHRMGKRYILYSSGNRINSLYGTGRVSGSHLHRLGAGRAFTDRGDHRGSLCHQSYRRCGCH
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|2298|1|49258-49537
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.174790326035263
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
phage capsid protein [Enterococcus gallinarum]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein [Blautia producta] |
1.48e-47 | 96 | 92.941 | WP_018597238 |
hypothetical protein [Coprococcus catus] hypothetical protein DW070_02775 [Coprococcus catus] |
4.65e-29 | 96 | 67.045 | WP_117527026 |
hypothetical protein [Eubacterium callanderi] hypothetical protein SAMN04487888_101445 [Eubacterium callanderi] |
6.95e-26 | 96 | 61.176 | WP_090410827 |
hypothetical protein [Faecalicatena fissicatena] |
1.95e-23 | 99 | 57.955 | WP_047775177 |
hypothetical protein [Erysipelatoclostridium sp. An15] |
1.07e-22 | 97 | 58.140 | WP_158095188 |
hypothetical protein [Coprobacillus sp. AF16-47] hypothetical protein DWW67_03170 [Coprobacillus sp. AF16-47] |
9.22e-22 | 96 | 54.118 | WP_117828499 |
hypothetical protein [Coprobacillus sp. AF21-8LB] hypothetical protein DWX89_03110 [Coprobacillus sp. AF21-8LB] |
9.32e-22 | 96 | 54.118 | WP_118536182 |
Uncharacterised protein [uncultured Clostridium sp.] |
9.32e-22 | 96 | 54.118 | SCJ34873 |
hypothetical protein [Coprobacillus sp. AF31-1BH] hypothetical protein DWZ30_02625 [Coprobacillus sp. AF31-1BH] |
9.32e-22 | 96 | 54.118 | WP_118469734 |
hypothetical protein [Faecalibacillus faecis] hypothetical protein C7U55_02575 [Faecalibacillus faecis] |
9.42e-22 | 96 | 54.118 | WP_106987216 |
hypothetical protein [Erysipelatoclostridium ramosum] hypothetical protein DXA75_12260 [Erysipelatoclostridium ramosum] |
2.19e-21 | 99 | 54.545 | WP_118232741 |
hypothetical protein [Coprobacillus sp. D7] hypothetical protein MBAG_00330 [Coprobacillus sp. D7] |
2.91e-21 | 99 | 54.545 | WP_009008617 |
hypothetical protein [Anaerofustis stercorihominis] |
7.42e-21 | 92 | 56.098 | WP_138268339 |
hypothetical protein [Clostridium sp. YH-panp20] hypothetical protein EDX97_09565 [Clostridium sp. YH-panp20] |
8.96e-20 | 92 | 56.098 | WP_128520924 |
hypothetical protein [Blautia hydrogenotrophica] hypothetical protein RUMHYD_02854 [Blautia hydrogenotrophica DSM 10507] putative uncharacterized protein [Blautia hydrogenotrophica CAG:147] |
6.19e-19 | 99 | 53.409 | WP_005950563 |
hypothetical protein [Lachnospiraceae bacterium M18-1] hypothetical protein C808_05339 [Lachnospiraceae bacterium M18-1] |
1.03e-18 | 100 | 50.505 | WP_016298705 |
Uncharacterised protein [Chlamydia trachomatis] |
1.09e-18 | 96 | 51.765 | CRH85790 |
hypothetical protein [Sellimonas intestinalis] hypothetical protein DWW28_15435 [Sellimonas intestinalis] hypothetical protein DW016_15065 [Sellimonas intestinalis] hypothetical protein DW008_14860 [Sellimonas intestinalis] |
6.48e-16 | 100 | 51.685 | WP_117493860 |
hypothetical protein [Ruminococcus sp. DSM 100440] hypothetical protein AXF09_15295 [Ruminococcus sp. DSM 100440] |
2.44e-15 | 100 | 50.562 | WP_062305048 |
hypothetical protein [Olsenella sp. oral taxon 807] hypothetical protein ADJ70_03295 [Olsenella sp. oral taxon 807] |
2.66e-07 | 84 | 42.105 | WP_050341105 |
phage capsid protein [Enterococcus gallinarum] phage capsid protein [Enterococcus gallinarum] |
5.11e-07 | 98 | 40.000 | WP_148408185 |
MULTISPECIES: phage capsid protein [Bacteria] Uncharacterised protein [Enterococcus saccharolyticus] |
5.42e-07 | 98 | 40.000 | WP_131731894 |
hypothetical protein [Olsenella profusa] hypothetical protein HMPREF1316_1517 [Olsenella profusa F0195] |
1.21e-06 | 84 | 40.789 | WP_021725427 |
phage capsid protein [Enterococcus gallinarum] phage capsid protein [Enterococcus gallinarum] phage capsid protein [Enterococcus gallinarum] |
1.58e-06 | 93 | 38.554 | WP_123837253 |
phage capsid protein [Enterococcus gallinarum] hypothetical protein EB54_03120 [Enterococcus gallinarum] |
1.59e-06 | 93 | 38.554 | WP_113850168 |
hypothetical protein [Ruminococcus sp.] hypothetical protein [Ruminococcus sp.] |
2.19e-06 | 87 | 40.260 | HCD40335 |
hypothetical protein [Olsenella uli] hypothetical protein HMPREF1503_1186 [Olsenella uli MSTE5] |
2.54e-06 | 78 | 44.286 | WP_036573527 |
phage capsid protein [Enterococcus mediterraneensis] |
3.43e-06 | 93 | 38.554 | WP_122645704 |
hypothetical protein [Enterococcus faecalis] hypothetical protein [Enterococcus phage phiFL2A] hypothetical protein [Enterococcus phage phiFL1A] conserved hypothetical protein [Enterococcus phage phiFL1B] conserved hypothetical protein [Enterococcus phage phiFL1C] head protein [Enterococcus phage phiFL2B] hypothetical protein Q97_02900 [Enterococcus faecalis EnGen0061] conserved hypothetical protein [Enterococcus phage phiFL1A] |
4.37e-06 | 98 | 38.889 | WP_010708426 |
hypothetical protein [Enterococcus faecalis] |
4.52e-06 | 98 | 38.889 | WP_048943749 |
phage capsid protein [Enterococcus faecium] phage capsid protein [Enterococcus faecium] phage capsid protein [Enterococcus faecium] phage capsid protein [Enterococcus faecium] phage capsid protein [Enterococcus faecium] hypothetical protein EA84_02148 [Enterococcus faecium] |
4.69e-06 | 98 | 38.889 | WP_104807899 |
phage capsid protein [Enterococcus faecium] hypothetical protein EB00_01914 [Enterococcus faecium] |
5.08e-06 | 98 | 38.889 | WP_113793563 |
phage capsid protein [Enterococcus faecium] phage capsid protein [Enterococcus faecium] |
9.8e-06 | 98 | 37.778 | WP_123830660 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_260 In blautia CP039126.1
Seq (len = 33 ):
LPRHLPSQPPLSNFHPQPKAVSQPPPPKPPAQS
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|162230|1|4435770-4435923
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.118615343229427
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_261 In bifi AE014295.3
Seq (len = 66 ):
LGCSGALDLASSSSSSSSTSSSSASSSSRSSSSASSSSTSSRSSSRSSTSKSSSLTSASSSSSSST
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|93159|-1|341448-341658
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6503987345506703
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_262 In bifi AE014295.3
Seq (len = 30 ):
CSFARVFYRVAAAEADVSAMLNGSAGFAGS
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|8504|1|391291-391381
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.95703092660682
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_263 In bifi AE014295.3
Seq (len = 18 ):
MALARMGFYMRSSGRPAP
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|66510|-1|1544613-1544784
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.660217415344002
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_264 In bifi AE014295.3
Seq (len = 103 ):
MRFTPTSANVSARPNSLVESTATPQLCSQPRQEVSLLAASNKSGTATTLTVRFNGDISEATSSSAPLPSSSRYSTDHAVLWPLANTAAFPPIKALISASVRAR
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|32293|1|1475332-1475683
Transkriptom
3.0% of gene length expressed over median expression of contig.
ŝ
1.7047995479967426
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_265 In bifi AE014295.3
Seq (len = 247 ):
LLRDRRQWPCRGHRRGRRHRVRQDRPRTARRQHRYDAAAGEAREARQGDRRGGLDCGRTGVRASGGPVRGFRHRLVRHDFRGVHHLHNADRGRRARRPADHRGRVPRGEHHQNVQAERAGQEDGGVRDHRLHQRDLLGQNRHVDPEPHDRDRGVQRAGPRLGEARADQEPHAAGELLRQRHRRRDLPGRHRSRGRRDAGIHRQPHRMRTVGRRAQGRTRLPDSPRARDGAPHVSVLVGDQEHDHCGA
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|18804|1|863537-864533
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9093892921715934
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_266 In bact CP040530.1
Seq (len = 30 ):
IGFPFFSVLIIGSRNRIILPKTGICIIISS
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|860|1|23148-23244
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.455105514901942
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 12 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_267 In bact CP040530.1
Seq (len = 76 ):
SCRTDDWGTGRNYIGEPRNLPHRRGGQSWQRLYTKEVRCEICPGRILCIRSVTLLQTSEINACHADNESDRTGYCS
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|526318|-1|8680-8908
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7763310333453155
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_268 In bact CP040530.1
Seq (len = 51 ):
MKKISAGWSLYSNGQPTSLSTVGQYTRTFLPLSCWNINVYGHKKTLPTKDS
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|43314|1|1093400-1093751
Transkriptom
75.0% of gene length expressed over median expression of contig.
ŝ
1.7460162035037419
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_269 In bact CP040530.1
Seq (len = 64 ):
TPKSMYPPFFPLTNSSAATGKKSSVRLVALKFFSIWLASRIMRSASLSANFLFPSFSLAIVSSR
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|426481|-1|2330814-2331006
Transkriptom
43.0% of gene length expressed over median expression of contig.
ŝ
1.8258432407215182
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_270 In bact CP040530.1
Seq (len = 25 ):
ISGYLWAKKHFPSSSWVAIDFSVRQ
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|411894|-1|2710978-2711089
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.3795169258452513
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_271 In bact CP040530.1
Seq (len = 40 ):
IRFTHFDAEYLYRADHFYLRFYVCCRIFTVRSVLLSVLRS
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|315810|-1|5062319-5062448
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7949761783458307
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_272 In bact CP040530.1
Seq (len = 35 ):
IVKVGSESFGAFRFEDSTESKLGFGSIPYFLISFG
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|171072|1|4002253-4002517
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.586700235918748
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 26 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_273 In bact CP040530.1
Seq (len = 250 ):
LTTGVGVRLMAVDAIYAQTVEHIKRAHPFGVTFGKVVVHGYYMHTVSGQRVQEYRKGSNESFTFTGCHFRNLTFVQNDTTEQLNVVMNHVPYRIIAAGIPVVLVDGFVAFNAYKVFGGSQMAVEFSRGYYDFFVFRKSFGSCFDDRESYGQYFFQCFLVFFENFFLYLIYLCKDFFAVFQFGAFDARFKFFHFSAFVSSRFADVFFEFFRFGTEGIVVQCFNLRVGSFDLFYPGFDFFHVSCGFVSENRA
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|129183|1|3054634-3056215
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.567565225478487
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 81 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_274 In anaero CP036345.1
Seq (len = 23 ):
MKWKSIHKLALTAVVYMQKNSGK
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|68035|1|1670930-1671002
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9580812160713177
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_275 In anaero CP036345.1
Seq (len = 38 ):
PDRNRAGTEDGGEKEPPEPDFFRRGTGMRRFKQYDSCW
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|64168|1|1573550-1573664
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.1882016490579357
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_276 In anaero CP036345.1
Seq (len = 47 ):
MINYREELKKFEPCLDVDQAEDAIYSDDLKDVEDLINEIKKDIEEEK
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|37055|1|877088-877256
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.7694659311884755
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_277 In anaero CP036345.1
Seq (len = 19 ):
IRKSNGNSRSDPQRKRSGC
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|15302|1|372260-372338
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6582358401256523
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 17 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_278 In anaero CP036345.1
Seq (len = 120 ):
TVWGRRYPREQCGLLDNFHGCKNAGRRFSQSSGDESDSAVSAFSKADLPSHGVRKKGKYFKCGFQSGHHGIEKKSFSLCIIESRLDRAYEISCQGNCRIRNYCKCHCSGIHEDGHADEIF
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|139404|-1|3535745-3536105
Transkriptom
4.0% of gene length expressed over median expression of contig.
ŝ
2.088132469594948
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
uncharacterized protein BN644_03004 [Bacteroides thetaiotaomicron CAG:40] |
3.28e-173 | 100 | 99.200 | CDE78591 |
uncharacterized protein BN759_00455 [Bacteroides sp. CAG:702] |
6.21e-59 | 99 | 42.231 | CCZ71032 |
hypothetical protein Barb4_02198 [Bacteroidales bacterium Barb4] |
4.02e-53 | 98 | 36.475 | OAV68116 |
unknown [Bacteroides sp. CAG:189] |
7.97e-48 | 69 | 53.488 | CCY50333 |
unknown [Bacteroides sp. CAG:633] |
2.8e-46 | 70 | 47.159 | CDB09545 |
uncharacterized protein BN530_00975 [Bacteroides sp. CAG:20] |
8.31e-43 | 89 | 39.732 | CCX96410 |
hypothetical protein Barb7_03100 [Bacteroidales bacterium Barb7] |
5.52e-36 | 82 | 33.981 | OAV72462 |
unknown [Parabacteroides johnsonii CAG:246] |
3.37e-34 | 72 | 41.667 | CCX77475 |
uncharacterized protein BN590_02092 [Alistipes sp. CAG:29] |
1.29e-33 | 99 | 35.857 | CDD25101 |
unknown [Prevotella sp. CAG:755] |
6.58e-31 | 55 | 41.304 | CCY15708 |
hypothetical protein ACD_77C00182G0002 [uncultured bacterium] |
4.45e-23 | 44 | 43.119 | EKD32057 |
uncharacterized protein BN523_00125 [Bacteroides sp. CAG:189] |
5.51e-16 | 24 | 62.712 | CCY50332 |
hypothetical protein HRbin20_01236 [bacterium HR20] |
2.08e-15 | 53 | 36.364 | GBD05647 |
hypothetical protein ALP17_05450 [Pseudomonas savastanoi] |
4.42e-15 | 33 | 45.122 | RMV05524 |
putative parvulin-type peptidyl-prolyl cis-trans isomerase precursor [Thalassobius mediterraneus] |
4.8e-14 | 36 | 47.312 | CUH85523 |
Uncharacterized protein ALO61_05272 [Pseudomonas savastanoi pv. nerii] |
1.4e-12 | 50 | 34.586 | KPY01852 |
hypothetical protein ALQ44_05743 [Pseudomonas syringae pv. pisi] |
1.72e-11 | 50 | 34.586 | RMO28542 |
hypothetical protein ALQ78_05778 [Pseudomonas syringae pv. aptata] |
8.49e-11 | 50 | 33.835 | RMM48134 |
hypothetical protein PAERUG_P3_North_West_16_VIM_2_07_06_04389 [Pseudomonas aeruginosa] |
9.22e-11 | 34 | 38.824 | CRP64095 |
hypothetical protein PAERUG_E15_London_28_01_14_00519 [Pseudomonas aeruginosa] hypothetical protein PAERUG_P5_London_26_VIM_2_01_09_03653 [Pseudomonas aeruginosa] |
1.11e-10 | 34 | 38.824 | CRP51536 |
hypothetical protein [Rhodocyclaceae bacterium] |
9.19e-10 | 30 | 40.541 | HCO76883 |
hypothetical protein ACD_74C00213G0003 [uncultured bacterium] |
6.34e-09 | 39 | 31.683 | EKD40736 |
hypothetical protein HRUBRA_02213 [Pseudohaliea rubra DSM 19751] |
1.6e-08 | 37 | 34.409 | KGE03265 |
uncharacterized protein BN680_00410 [Ruminococcus sp. CAG:488] |
2.44e-08 | 29 | 43.056 | CDA19357 |
uncharacterized protein BN552_00881 [Blautia sp. CAG:237] |
1.51e-07 | 26 | 40.625 | CDB78627 |
hypothetical protein A4E66_01181 [Syntrophus sp. PtaB.Bin001] |
1.83e-07 | 31 | 37.179 | OPY12286 |
hypothetical protein A4E61_01941 [Syntrophorhabdus sp. PtaB.Bin184] |
1.91e-07 | 31 | 35.065 | OPY00625 |
hypothetical protein AW08_02676 [Candidatus Accumulibacter sp. SK-12] |
4.03e-07 | 27 | 32.836 | EXI66320 |
hypothetical protein DO74_4 [Brucella abortus bv. 6 str. 870] Uncharacterised protein [Brucella suis] |
5.17e-07 | 32 | 35.802 | AIJ63764 |
hypothetical protein FAZ92_03708 [Candidatus Accumulibacter sp.] |
1.73e-06 | 28 | 36.232 | TLD44060 |
hypothetical protein AUH78_27720 [Gemmatimonadetes bacterium 13_1_40CM_4_69_8] |
2.36e-06 | 36 | 30.337 | OLC67603 |
uncharacterized protein BN744_00881 [Bacteroides sp. CAG:633] |
2.52e-06 | 22 | 53.704 | CDB09544 |
hypothetical protein HRbin36_02464 [bacterium HR36] |
4.56e-06 | 26 | 35.938 | GBD37333 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_279 In lacto CP039121.1
Seq (len = 18 ):
MRKASNNFVSLLNIMVGT
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|79684|1|1448578-1448635
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.4966633624435621
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_280 In lacto CP039121.1
Seq (len = 36 ):
LFYTRKPLKHDMFFHDSSKNEKSSQNIAVFGRKINK
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|58677|1|1062937-1063066
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.5729468864354987
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_281 In lacto CP039121.1
Seq (len = 28 ):
IPKKALAKAIPANVEALCIFSRAILSPS
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|337170|-1|26731-26884
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0037802905337267
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 29 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
DNA-directed RNA polymerase specialized sigma subunit [Clostridium sp. SY8519]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
putative uncharacterized protein [Anaerostipes sp. CAG:276] |
6.76e-23 | 100 | 100.000 | CDC34029 |
hypothetical protein AR1Y2_2805 [Anaerostipes rhamnosivorans] |
3.68e-15 | 74 | 100.000 | QCP36259 |
hypothetical protein SAMN05661086_01875 [[Clostridium] populeti] |
1.32e-11 | 91 | 67.442 | SFR81205 |
putative uncharacterized protein [Firmicutes bacterium CAG:227] |
2.08e-10 | 94 | 68.182 | CDC91757 |
hypothetical protein BLAHAN_06400 [Blautia hansenii DSM 20583] hypothetical protein HMPREF0992_00751 [Lachnospiraceae bacterium 6_1_63FAA] putative uncharacterized protein [Lachnospiraceae bacterium CAG:364] |
2.89e-10 | 89 | 66.667 | EEX20948 |
Uncharacterised protein [Fusicatenibacter saccharivorans] |
3.21e-10 | 89 | 66.667 | CUP17284 |
putative uncharacterized protein [Blautia sp. CAG:37] Uncharacterised protein [Fusicatenibacter saccharivorans] Uncharacterised protein [Fusicatenibacter saccharivorans] |
3.35e-10 | 89 | 66.667 | CDE64718 |
hypothetical protein SAMN02745158_00858 [Lactonifactor longoviformis DSM 17459] |
5.23e-10 | 83 | 71.795 | SHE54666 |
putative uncharacterized protein [Firmicutes bacterium CAG:424] |
7.68e-10 | 89 | 66.667 | CDC42892 |
putative uncharacterized protein [Firmicutes bacterium CAG:646] |
1.3e-09 | 85 | 62.500 | CCZ33500 |
hypothetical protein CLOL250_02873 [Clostridium sp. L2-50] |
2.06e-09 | 83 | 64.103 | EDO56438 |
putative uncharacterized protein [Roseburia sp. CAG:197] |
2.33e-09 | 96 | 57.778 | CDA25068 |
uncharacterized protein BN572_01524 [Clostridium sp. CAG:264] Uncharacterised protein [uncultured Coprococcus sp.] |
2.43e-09 | 83 | 64.103 | CCY60419 |
uncharacterized protein BN724_01900 [Clostridium sp. CAG:590] |
2.9e-09 | 100 | 51.064 | CCX88511 |
hypothetical protein lbkm_4263 [Lachnospiraceae bacterium KM106-2] |
3.57e-09 | 89 | 61.905 | BBF45496 |
hypothetical protein CC1_14530 [Coprococcus catus GD/7] |
3.86e-09 | 91 | 55.814 | CBK80234 |
putative uncharacterized protein [Blautia sp. CAG:52] putative uncharacterized protein [Roseburia sp. CAG:471] Uncharacterised protein [uncultured Blautia sp.] |
4.31e-09 | 87 | 60.976 | CDB19896 |
Uncharacterised protein [uncultured Clostridium sp.] |
5.67e-09 | 100 | 61.702 | SCH67232 |
MULTISPECIES: hypothetical protein [unclassified Clostridium] putative uncharacterized protein [Clostridium sp. CAG:127] hypothetical protein [Lachnospiraceae bacterium] hypothetical protein DWW62_07430 [Clostridium sp. AF16-25] hypothetical protein DWW48_00450 [Clostridium sp. AF15-49] hypothetical protein DWW54_03125 [Clostridium sp. AF15-6B] |
8.21e-09 | 91 | 53.488 | WP_021984978 |
hypothetical protein PMF13cell1_01876 [Blautia producta] hypothetical protein EV205_12445 [Blautia coccoides] DNA-directed RNA polymerase specialized sigma subunit [Blautia coccoides] |
8.32e-09 | 89 | 64.286 | QBE96332 |
putative uncharacterized protein [Firmicutes bacterium CAG:56] Uncharacterised protein [uncultured Ruminococcus sp.] Uncharacterised protein [uncultured Ruminococcus sp.] |
8.41e-09 | 89 | 61.905 | CDA64059 |
Uncharacterised protein [uncultured Clostridium sp.] |
1.04e-08 | 89 | 61.905 | SCG89478 |
putative uncharacterized protein [Roseburia sp. CAG:18] hypothetical protein M72_01411 [Roseburia faecis] Uncharacterised protein [Roseburia faecis] |
1.25e-08 | 96 | 53.333 | CCZ79424 |
hypothetical protein COPEUT_02911 [Coprococcus eutactus ATCC 27759] uncharacterized protein BN751_00722 [Coprococcus eutactus CAG:665] |
1.57e-08 | 87 | 56.098 | EDP24973 |
hypothetical protein CCU_00980 [Coprococcus sp. ART55/1] putative uncharacterized protein [Coprococcus sp. CAG:131] Uncharacterised protein [Coprococcus eutactus] Uncharacterised protein [Coprococcus eutactus] Uncharacterised protein [Coprococcus eutactus] |
1.76e-08 | 87 | 56.098 | CBK82045 |
hypothetical protein BRYFOR_09498 [Marvinbryantia formatexigens DSM 14469] hypothetical protein SAMN05660368_03259 [Marvinbryantia formatexigens] |
2.16e-08 | 100 | 57.447 | EET58574 |
hypothetical protein C810_04478 [Lachnospiraceae bacterium A2] |
2.95e-08 | 100 | 53.191 | EOS42608 |
uncharacterized protein BN781_01812 [Coprococcus sp. CAG:782] |
3.75e-08 | 87 | 58.537 | CCY53426 |
Uncharacterised protein [[Ruminococcus] torques] |
4.93e-08 | 83 | 53.846 | CUQ86757 |
hypothetical protein SAMN02910358_01490 [Lachnospiraceae bacterium XBB1006] |
5.1e-08 | 83 | 61.538 | SFQ30267 |
hypothetical protein C806_00217 [Lachnospiraceae bacterium 3-1] |
5.21e-08 | 98 | 54.348 | EOS27249 |
putative uncharacterized protein [Ruminococcus sp. CAG:55] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [[Ruminococcus] torques] |
5.81e-08 | 83 | 53.846 | CDC16453 |
Uncharacterised protein [uncultured Eubacterium sp.] Uncharacterised protein [uncultured Ruminococcus sp.] |
6.17e-08 | 83 | 56.410 | SCH33250 |
hypothetical protein RHS_0258 [Robinsoniella sp. RHS] hypothetical protein DSM106044_01009 [Robinsoniella peoriensis] |
6.21e-08 | 100 | 57.447 | KLU74163 |
hypothetical protein SAMN05421659_101408 [[Clostridium] fimetarium] |
9.65e-08 | 83 | 58.974 | SEV86094 |
uncharacterized protein BN568_01760 [Blautia sp. CAG:257] |
1.11e-07 | 89 | 57.143 | CDA05273 |
hypothetical protein SAMN04487772_101176 [[Clostridium] polysaccharolyticum] |
1.31e-07 | 96 | 55.556 | SES64497 |
UNVERIFIED_CONTAM: hypothetical protein C7383_1178 [Murimonas intestini] |
1.31e-07 | 77 | 63.889 | PWJ72538 |
hypothetical protein SAMN02746066_02933 [Anaerosporobacter mobilis DSM 15930] |
1.36e-07 | 83 | 58.974 | SHM68479 |
hypothetical protein C805_02839 [Eubacterium sp. 14-2] |
1.42e-07 | 83 | 61.538 | EOT24627 |
hypothetical protein RSAG_02827 [Ruminococcus sp. 5_1_39BFAA] putative uncharacterized protein [Ruminococcus sp. CAG:9] Uncharacterised protein [Blautia obeum] Uncharacterised protein [Blautia wexlerae] Uncharacterised protein [Blautia obeum] |
1.53e-07 | 89 | 57.143 | EES75939 |
hypothetical protein SAMN02745136_04166 [Anaerocolumna jejuensis DSM 15929] hypothetical protein SAMN02745217_03412 [Anaerocolumna xylanovorans DSM 12503] |
1.65e-07 | 91 | 53.488 | SHL13682 |
hypothetical protein Cphy_0474 [Lachnoclostridium phytofermentans ISDg] |
1.87e-07 | 83 | 56.410 | ABX40861 |
uncharacterized protein BN730_00437 [Eubacterium sp. CAG:603] Uncharacterised protein [uncultured Eubacterium sp.] |
1.88e-07 | 91 | 53.488 | CCZ03613 |
hypothetical protein [Eisenbergiella tayi] |
1.97e-07 | 89 | 57.143 | WP_154465720 |
putative uncharacterized protein [Ruminococcus sp. CAG:60] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Ruminococcus sp.] Uncharacterised protein [uncultured Clostridium sp.] |
2.24e-07 | 89 | 57.143 | CCY32428 |
putative uncharacterized protein [Eubacterium sp. CAG:86] |
2.32e-07 | 96 | 53.333 | CCX82769 |
uncharacterized protein BN552_00984 [Blautia sp. CAG:237] |
2.37e-07 | 100 | 51.064 | CDB78743 |
hypothetical protein RUMOBE_03249 [Blautia obeum ATCC 29174] uncharacterized protein BN639_00681 [Ruminococcus obeum CAG:39] Uncharacterised protein [Blautia obeum] Uncharacterised protein [uncultured Ruminococcus sp.] Uncharacterised protein [Blautia obeum] |
2.64e-07 | 89 | 57.143 | EDM86143 |
hypothetical protein [Clostridium sp. KLE 1755] hypothetical protein HMPREF1548_05897 [Clostridium sp. KLE 1755] |
2.7e-07 | 89 | 57.143 | WP_021639373 |
hypothetical protein CK5_20400 [Blautia obeum A2-162] Uncharacterised protein [uncultured Ruminococcus sp.] |
2.7e-07 | 89 | 57.143 | CBL23414 |
Uncharacterised protein [uncultured Blautia sp.] |
2.7e-07 | 89 | 57.143 | SCH43582 |
putative uncharacterized protein [Eubacterium eligens CAG:72] Uncharacterised protein [[Eubacterium] eligens] Uncharacterised protein [[Eubacterium] eligens] |
2.96e-07 | 83 | 56.410 | CDA39354 |
Hypothetical protein EUBELI_01611 [[Eubacterium] eligens ATCC 27750] |
3.06e-07 | 83 | 56.410 | ACR72602 |
hypothetical protein AMURIS_02282 [Acetatifactor muris] |
3.08e-07 | 100 | 54.902 | SOY29561 |
hypothetical protein [Eubacteriaceae bacterium] |
3.19e-07 | 94 | 52.273 | WP_147591305 |
putative uncharacterized protein [Clostridium sp. CAG:75] |
4.84e-07 | 87 | 56.098 | CCZ51858 |
hypothetical protein RUMHYD_02748 [Blautia hydrogenotrophica DSM 10507] putative uncharacterized protein [Blautia hydrogenotrophica CAG:147] Uncharacterised protein [Blautia hydrogenotrophica] Uncharacterised protein [uncultured Blautia sp.] |
5.11e-07 | 89 | 61.905 | EEG48344 |
putative uncharacterized protein [Eubacterium sp. CAG:38] |
5.47e-07 | 91 | 55.814 | CDE37239 |
hypothetical protein C823_01980 [Eubacterium plexicaudatum ASF492] |
5.97e-07 | 89 | 52.381 | EMZ28447 |
hypothetical protein [Lachnoclostridium phytofermentans] |
6.14e-07 | 83 | 56.410 | WP_157668643 |
hypothetical protein EV212_103221 [Frisingicoccus caecimuris] |
6.16e-07 | 91 | 55.814 | TCO85499 |
hypothetical protein SAMN02910417_00420 [Eubacterium oxidoreducens] |
6.22e-07 | 89 | 52.381 | SDB06084 |
putative uncharacterized protein [Butyrivibrio sp. CAG:318] |
9.06e-07 | 100 | 48.936 | CDC36917 |
putative uncharacterized protein [Roseburia sp. CAG:45] Uncharacterised protein [uncultured Roseburia sp.] |
9.48e-07 | 89 | 52.381 | CDC12085 |
hypothetical protein SAMN02910289_01968 [Lachnospiraceae bacterium RM5] |
9.68e-07 | 83 | 56.410 | SEQ41433 |
hypothetical protein HMPREF9477_01848 [Lachnospiraceae bacterium 2_1_46FAA] |
9.92e-07 | 83 | 51.282 | EGG80989 |
hypothetical protein EDC19_2181 [Natranaerovirga hydrolytica] |
9.99e-07 | 98 | 43.478 | TCK92446 |
putative uncharacterized protein [Roseburia sp. CAG:100] |
1.17e-06 | 98 | 52.174 | CDF46016 |
hypothetical protein EDC18_10679 [Natranaerovirga pectinivora] |
1.26e-06 | 91 | 48.837 | TCT14282 |
putative uncharacterized protein [Ruminococcus sp. CAG:17] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Blautia sp.] Uncharacterised protein [uncultured Blautia sp.] |
1.39e-06 | 100 | 46.809 | CCY96971 |
hypothetical protein SAMN02910453_2010 [Lachnospiraceae bacterium A10] |
1.5e-06 | 87 | 53.659 | SEJ07550 |
hypothetical protein C808_02899 [Lachnospiraceae bacterium M18-1] |
1.63e-06 | 83 | 53.846 | EOS38689 |
hypothetical protein C824_05596 [Schaedlerella arabinosiphila] |
1.68e-06 | 83 | 53.846 | EMZ20644 |
DNA-directed RNA polymerase specialized sigma subunit [Clostridium sp. SY8519] |
1.73e-06 | 83 | 56.410 | BAK47348 |
hypothetical protein C8E03_11455 [Lachnotalea glycerini] |
1.75e-06 | 77 | 61.111 | PXV85977 |
hypothetical protein HMPREF0373_02276 [Eubacterium ramulus ATCC 29099] putative uncharacterized protein [Roseburia sp. CAG:50] Uncharacterised protein [Eubacterium ramulus] |
1.79e-06 | 89 | 54.762 | ERK43710 |
hypothetical protein EDD66_10611 [Mobilisporobacter senegalensis] |
1.94e-06 | 91 | 53.488 | ROR27317 |
hypothetical protein SAMN02745687_01485 [Lachnospiraceae bacterium NK3A20] |
1.95e-06 | 89 | 50.000 | SEA02873 |
putative uncharacterized protein [Clostridium sp. CAG:253] |
2.02e-06 | 87 | 51.220 | CDB89514 |
uncharacterized protein BN525_01345 [Eubacterium sp. CAG:192] |
2.02e-06 | 89 | 47.826 | CDB13466 |
hypothetical protein T1815_19841 [[Eubacterium] rectale] Uncharacterised protein [[Eubacterium] rectale] |
2.04e-06 | 89 | 50.000 | CRL39046 |
hypothetical protein SAMN06297422_11745 [Lachnospiraceae bacterium] |
2.04e-06 | 91 | 48.837 | SNU08299 |
hypothetical protein SAMN02910368_00718 [Lachnospiraceae bacterium G11] |
2.16e-06 | 98 | 50.000 | SDA47830 |
Hypothetical protein EUBREC_2576 [[Eubacterium rectale] ATCC 33656] [[Eubacterium] rectale ATCC 33656] hypothetical protein EUR_25680 [[Eubacterium] rectale DSM 17629] hypothetical protein ERE_08460 [[Eubacterium] rectale M104/1] putative uncharacterized protein [Eubacterium rectale CAG:36] Uncharacterised protein [[Ruminococcus] torques] Uncharacterised protein [[Eubacterium] rectale] |
2.22e-06 | 89 | 50.000 | ACR76307 |
hypothetical protein DORFOR_01399 [Dorea formicigenerans ATCC 27755] hypothetical protein HMPREF9457_01702 [Dorea formicigenerans 4_6_53AFAA] putative uncharacterized protein [Dorea formicigenerans CAG:28] Uncharacterised protein [uncultured Dorea sp.] Uncharacterised protein [Dorea formicigenerans] |
2.24e-06 | 81 | 55.263 | EDR47433 |
putative uncharacterized protein [Clostridium sp. CAG:167] |
2.38e-06 | 89 | 45.238 | CCZ90322 |
hypothetical protein GCWU000342_01684 [Shuttleworthia satelles DSM 14600] hypothetical protein HMPREF1508_1190 [Shuttleworthia sp. MSX8B] |
2.51e-06 | 89 | 52.381 | EEP27690 |
uncharacterized protein BN504_00481 [Eubacterium sp. CAG:156] |
2.6e-06 | 83 | 51.282 | CDA28945 |
hypothetical protein [Kineothrix alysoides] hypothetical protein EDD76_102170 [Kineothrix alysoides] |
2.79e-06 | 96 | 55.556 | WP_035315086 |
hypothetical protein [Lachnospiraceae bacterium] |
2.92e-06 | 91 | 51.163 | HBA68117 |
hypothetical protein [Roseburia inulinivorans] hypothetical protein ROSEINA2194_02482 [Roseburia inulinivorans DSM 16841] putative uncharacterized protein [Roseburia inulinivorans CAG:15] hypothetical protein BHW47_06670 [Roseburia inulinivorans] hypothetical protein DWY96_10710 [Roseburia inulinivorans] hypothetical protein DWY29_10815 [Roseburia inulinivorans] |
2.93e-06 | 98 | 43.478 | WP_007886736 |
Uncharacterised protein [Dorea longicatena] |
3.13e-06 | 83 | 53.846 | VUX15454 |
putative uncharacterized protein [Firmicutes bacterium CAG:194] |
3.2e-06 | 98 | 50.000 | CCZ28877 |
hypothetical protein [Roseburia inulinivorans] Uncharacterised protein [Roseburia inulinivorans] hypothetical protein [Roseburia sp.] |
3.34e-06 | 98 | 43.478 | WP_070102896 |
hypothetical protein C7390_1810 [Bacteroides galacturonicus] Uncharacterised protein [Lachnospira pectinoschiza] Uncharacterised protein [Lachnospira pectinoschiza] hypothetical protein SAMN02982992_01960 [Lactobacillus rogosae] |
3.54e-06 | 83 | 53.846 | PVX56581 |
MULTISPECIES: hypothetical protein [Bacteria] hypothetical protein C807_01942 [Lachnospiraceae bacterium 28-4] hypothetical protein D6D47_27955 [bacterium 1XD8-92] |
3.64e-06 | 91 | 51.163 | WP_016291684 |
MULTISPECIES: hypothetical protein [unclassified Clostridium] hypothetical protein BHW08_03080 [Clostridium sp. CAG:12237_41] putative uncharacterized protein [Clostridium sp. CAG:122] hypothetical protein APZ18_09615 [Lachnospiraceae bacterium TF01-11] hypothetical protein DWZ63_11930 [Clostridium sp. AF34-13] hypothetical protein DW721_00825 [Clostridium sp. AM27-31LB] |
3.65e-06 | 87 | 51.220 | WP_022013315 |
hypothetical protein RUMLAC_02034 [Ruminococcus lactaris ATCC 29176] hypothetical protein HMPREF1202_01471 [Ruminococcus lactaris CC59_002D] |
3.65e-06 | 83 | 51.282 | EDY32155 |
hypothetical protein ROI_29230 [Roseburia intestinalis M50/1] putative uncharacterized protein [Roseburia intestinalis CAG:13] Uncharacterised protein [Roseburia intestinalis] hypothetical protein RIL182_00846 [Roseburia intestinalis L1-82] |
3.86e-06 | 91 | 46.512 | CBL09817 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_282 In lacto CP039121.1
Seq (len = 44 ):
MKNNDEFTKSWVRTCPPFEHCSDWKAFQPMLSGEIPLSKRPWLG
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|303890|-1|664229-664379
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.7273849391506013
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_283 In lacto CP039121.1
Seq (len = 21 ):
VLRGARCQVGWDANEFIGTGQ
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|230948|-1|2117750-2117813
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.5765902722669063
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_284 In lacto CP039121.1
Seq (len = 34 ):
ISPRRCDQQPVLTATPIVDGCRAVFSTLTPITDF
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|219612|-1|2328425-2328548
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.8277863960075205
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_285 In lacto CP039121.1
Seq (len = 19 ):
MIPLISPIPSPLLSLKLFG
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|115126|1|2156571-2156640
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.6812412373755872
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_286 In ery NZ_CP036346.1
Seq (len = 16 ):
LNTEQLGYNFQRLQNI
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|95577|1|1368208-1368256
Transkriptom
96.0% of gene length expressed over median expression of contig.
ŝ
1.7455324895329236
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_287 In ery NZ_CP036346.1
Seq (len = 18 ):
INLVIMVYYNKESNNYEK
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|416883|-1|245126-245204
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8728952016351923
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein N644_1505 [Lactobacillus paraplantarum] hypothetical protein FD48_GL002588 [Lactobacillus paraplantarum DSM 10667] |
4.58e-15 | 100 | 70.455 | ERL44485 |
hypothetical protein [Lactobacillus plantarum] hypothetical protein B1H25_02375 [Lactobacillus plantarum] hypothetical protein DVH03_03725 [Lactobacillus plantarum] hypothetical protein E2P76_02140 [Lactobacillus plantarum] hypothetical protein FGO87_13720 [Lactobacillus plantarum] hypothetical protein FGO88_13575 [Lactobacillus plantarum] |
9.75e-15 | 91 | 80.000 | WP_076632844 |
hypothetical protein [Lactobacillus plantarum] hypothetical protein EPT59_02635 [Lactobacillus plantarum] |
1.02e-14 | 91 | 80.000 | WP_128383239 |
hypothetical protein [Lactobacillus plantarum] |
1.16e-14 | 100 | 68.182 | WP_154815494 |
MULTISPECIES: hypothetical protein [Lactobacillus] hypothetical protein FEM46_12585 [Lactobacillus plantarum subsp. plantarum] hypothetical protein BWL06_04885 [Lactobacillus plantarum] hypothetical protein CJP43_13705 [Lactobacillus plantarum] hypothetical protein DB342_06300 [Lactobacillus plantarum] hypothetical protein DB340_03145 [Lactobacillus plantarum] |
1.19e-14 | 91 | 80.000 | WP_071542854 |
hypothetical protein DA080_12470 [Lactobacillus plantarum] hypothetical protein DA076_12645 [Lactobacillus plantarum] |
1.67e-14 | 91 | 80.000 | AVV99944 |
hypothetical protein D2U09_13685 [Lactobacillus plantarum] |
1.71e-14 | 91 | 80.000 | RHX73186 |
hypothetical protein BV221_13350, partial [Lactobacillus plantarum] |
1.81e-14 | 91 | 80.000 | TAR00398 |
hypothetical protein BV237_10395, partial [Lactobacillus plantarum] hypothetical protein BV239_13160, partial [Lactobacillus plantarum] hypothetical protein BV241_09905, partial [Lactobacillus plantarum] hypothetical protein BV238_09575, partial [Lactobacillus plantarum] hypothetical protein BV240_10305, partial [Lactobacillus plantarum] |
3.66e-13 | 86 | 78.947 | TAR51012 |
hypothetical protein, partial [Lactobacillus plantarum] hypothetical protein L103_13930, partial [Lactobacillus plantarum IPLA88] |
2.54e-12 | 84 | 78.378 | WP_016511813 |
hypothetical protein HMPREF0531_11342 [Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437] |
6.29e-12 | 100 | 68.182 | EFK29650 |
hypothetical protein BV265_14020, partial [Lactobacillus plantarum] |
1.95e-11 | 82 | 77.778 | TAS34147 |
hypothetical protein Nizo2257_2559 [Lactobacillus plantarum] hypothetical protein Nizo2753_1065 [Lactobacillus plantarum] |
2.83e-11 | 100 | 65.909 | KZT93772 |
hypothetical protein WP50_34315 [Lactobacillus plantarum] |
8.55e-09 | 100 | 65.909 | KLD57371 |
hypothetical protein Nizo2757_1740 [Lactobacillus plantarum] hypothetical protein Nizo2766_1138 [Lactobacillus plantarum] |
3.76e-08 | 98 | 58.140 | KZU44880 |
hypothetical protein, partial [Lactobacillus plantarum] hypothetical protein DQM22_07940, partial [Lactobacillus plantarum] |
6.3e-07 | 68 | 73.333 | WP_114684994 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_288 In ery NZ_CP036346.1
Seq (len = 18 ):
VSQFQSYQCKNVLIKWYQ
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|393009|-1|617200-617263
Transkriptom
38.0% of gene length expressed over median expression of contig.
ŝ
1.9888526392242025
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_289 In ery NZ_CP036346.1
Seq (len = 115 ):
ITVASHAKALATSTPSTVKGKLLTNKNPNAIIWLTVFSLPSLLAATTTCLLAADILIASTIVSREIIIIGIIILIVWSLANNKKIVLINNLSAIGSANLPNVVINFSFRAIFPSK
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|361994|-1|1105595-1105961
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.474091784166044
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_290 In ery NZ_CP036346.1
Seq (len = 16 ):
INKLEYVHWYNDVRRF
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|213214|1|3205741-3205813
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.8559449729446271
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_291 In ery NZ_CP036346.1
Seq (len = 18 ):
IPCKSPIPSPLLSLKLLG
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|185172|1|2745933-2746002
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.6812412373755872
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_292 In ecoli U00096.3
Seq (len = 31 ):
VAVVAGAVANAAPPVPLADVTNGRSPAPVVQ
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|38729|1|1055760-1055853
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.5238449180523579
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_293 In ecoli U00096.3
Seq (len = 81 ):
KYPAEFDRRFSDASQRFADYRWRRSHNYAAVTPSGVDAVSGEQPVQPPDGRTEHRAGAKSGIETERGTAGENARYRPPDGD
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|335743|-1|72571-72814
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.5543957967264024
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_294 In ecoli U00096.3
Seq (len = 77 ):
MLTNRNTLIVKLNLITMPEQIIKVSECQPTTVWRIVVLFTKQRQQLLASRECDIYRSGKDLFNLSLPPLRQKIRIRS
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|326631|-1|335936-336251
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.5883802940367697
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_295 In ecoli U00096.3
Seq (len = 17 ):
LALFPAPMAPDAPERDR
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|321381|-1|493451-493850
Transkriptom
95.0% of gene length expressed over median expression of contig.
ŝ
1.8859453044078711
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_296 In ecoli U00096.3
Seq (len = 27 ):
ITAASGRSHQEHISAVDLAHLPCSALR
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|314611|-1|681136-681265
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7833943057960153
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_297 In ecoli U00096.3
Seq (len = 56 ):
IQAITSYSAGRSRICCRNASAITSLMTISLPVFGFLTFSHGPPSISSPPNSSRASW
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|296680|-1|1195859-1196042
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.3847515550905416
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 21 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_298 In ecoli U00096.3
Seq (len = 34 ):
NLADRGQTPWLRSGECGRANQWYCRTLCRCSAAQ
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|271187|-1|1858988-1859090
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.898596649444669
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_299 In ecoli U00096.3
Seq (len = 9 ):
LYHQDLNPV
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|268862|-1|1918443-1918470
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.6819366650372383
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein, partial [Escherichia coli] hypothetical protein EC75_19356, partial [Escherichia coli 75] |
8.26e-48 | 100 | 100.000 | WP_000718283 |
FIG00640511: hypothetical protein [Escherichia coli] |
8.73e-48 | 100 | 100.000 | CTP95283 |
hypothetical protein [Escherichia coli] hypothetical protein ECE128010_3394 [Escherichia coli E128010] hypothetical protein SS53G_5406 [Shigella sonnei 53G] hypothetical protein ECOK1357_1988 [Escherichia coli OK1357] hypothetical protein ECDEC9C_0367 [Escherichia coli DEC9C] hypothetical protein OQE_39000 [Escherichia coli J53] hypothetical protein ECAI27_30230 [Escherichia coli AI27] hypothetical protein SS323385_0361 [Shigella sonnei 3233-85] hypothetical protein ECMP0210179_0371 [Escherichia coli MP021017.9] hypothetical protein ECMP0210176_0364 [Escherichia coli MP021017.6] hypothetical protein ECMP0210175_0249 [Escherichia coli MP021017.5] hypothetical protein ECMP0210173_0362 [Escherichia coli MP021017.3] hypothetical protein ECMP0210172_0366 [Escherichia coli MP021017.2] hypothetical protein EC2731150_0367 [Escherichia coli 2731150] hypothetical protein ECBCE008MS13_0380 [Escherichia coli BCE008_MS-13] hypothetical protein ECP02989428_0333 [Escherichia coli P0298942.8] hypothetical protein ECP02989429_0298 [Escherichia coli P0298942.9] hypothetical protein ECP02994831_0529 [Escherichia coli P0299483.1] hypothetical protein ECP03052603_0390 [Escherichia coli P0305260.3] hypothetical protein ECP03052606_0384 [Escherichia coli P0305260.6] hypothetical protein ECP03052607_0392 [Escherichia coli P0305260.7] hypothetical protein AC13_0291 [Escherichia coli 2-011-08_S3_C2] hypothetical protein AC42_0335 [Escherichia coli 2-052-05_S3_C3] hypothetical protein AD22_0277 [Escherichia coli 6-537-08_S4_C2] Uncharacterised protein [Shigella sonnei] |
8.89e-48 | 100 | 100.000 | WP_001342770 |
hypothetical protein ECP029894215_0350 [Escherichia coli P0298942.15] hypothetical protein ECP02989424_0316 [Escherichia coli P0298942.4] hypothetical protein AB68_0427 [Escherichia coli 7-233-03_S1_C3] |
9.89e-48 | 100 | 100.000 | ENB67030 |
hypothetical protein [Escherichia coli] hypothetical protein EC1011_2812 [Escherichia coli 101-1] hypothetical protein ECSTEC94C_0339 [Escherichia coli STEC_94C] hypothetical protein ECSTECEH250_0386 [Escherichia coli STEC_EH250] hypothetical protein ECDEC8C_0517 [Escherichia coli DEC8C] hypothetical protein ECDEC10A_0444 [Escherichia coli DEC10A] hypothetical protein ECDEC10D_0379 [Escherichia coli DEC10D] hypothetical protein ECMP0210174_0271 [Escherichia coli MP021017.4] hypothetical protein ECMP02101710_0365 [Escherichia coli MP021017.10] hypothetical protein ECMP02101712_0251 [Escherichia coli MP021017.12] hypothetical protein EC2762100_0303 [Escherichia coli 2762100] hypothetical protein EC174750_0286 [Escherichia coli 174750] hypothetical protein ECMP0210171_0559 [Escherichia coli MP021017.1] hypothetical protein EC2875150_0309 [Escherichia coli 2875150] hypothetical protein ECBCE008MS01_0274 [Escherichia coli BCE008_MS-01] hypothetical protein ECP029894210_0322 [Escherichia coli P0298942.10] hypothetical protein ECP02989422_0315 [Escherichia coli P0298942.2] hypothetical protein ECP02994384_0396 [Escherichia coli P0299438.4] hypothetical protein ECP02994389_0849 [Escherichia coli P0299438.9] hypothetical protein ECP030230811_0394 [Escherichia coli P0302308.11] hypothetical protein ECP030529313_0307 [Escherichia coli p0305293.13] hypothetical protein ECP02994833_0344 [Escherichia coli P0299483.3] hypothetical protein ECP03019043_0344 [Escherichia coli P0301904.3] hypothetical protein ECP03022939_0332 [Escherichia coli P0302293.9] hypothetical protein ECP030526010_0402 [Escherichia coli P0305260.10] hypothetical protein ECP030526011_0410 [Escherichia coli P0305260.11] hypothetical protein ECP030526012_1381 [Escherichia coli P0305260.12] hypothetical protein ECP030526015_0403 [Escherichia coli P0305260.15] hypothetical protein ECP03052605_0387 [Escherichia coli P0305260.5] hypothetical protein ECP030529312_0315 [Escherichia coli p0305293.12] hypothetical protein ECP030529311_0314 [Escherichia coli p0305293.11] hypothetical protein ECP03052933_0379 [Escherichia coli p0305293.3] hypothetical protein ECP029894214_0326 [Escherichia coli P0298942.14] hypothetical protein ECP03018673_0350 [Escherichia coli P0301867.3] hypothetical protein ECP030230812_0431 [Escherichia coli P0302308.12] hypothetical protein ECP030230813_0349 [Escherichia coli P0302308.13] hypothetical protein L341_3652 [Escherichia coli CE418] hypothetical protein EN35_04555 [Rhodococcus qingshengii] hypothetical protein AB83_0388 [Escherichia coli 2-011-08_S3_C1] hypothetical protein AD43_4066 [Escherichia coli 3-105-05_S4_C3] hypothetical protein AC59_1432 [Escherichia coli 3-373-03_S3_C3] hypothetical protein AB47_0654 [Escherichia coli 3-373-03_S1_C2] hypothetical protein AC58_2396 [Escherichia coli 3-105-05_S3_C3] hypothetical protein AB77_4142 [Escherichia coli 3-373-03_S1_C3] hypothetical protein AB19_4633 [Escherichia coli 3-373-03_S1_C1] hypothetical protein AD18_3719 [Escherichia coli 3-475-03_S4_C2] hypothetical protein AD25_0296 [Escherichia coli 2-052-05_S4_C3] hypothetical protein AC65_2993 [Escherichia coli 2-005-03_S4_C1] hypothetical protein AC46_4929 [Escherichia coli 2-222-05_S3_C3] hypothetical protein AC48_3293 [Escherichia coli 2-427-07_S3_C3] hypothetical protein AC73_4585 [Escherichia coli 2-427-07_S4_C1] hypothetical protein AC50_2982 [Escherichia coli 2-474-04_S3_C3] hypothetical protein AB78_4753 [Escherichia coli 4-203-08_S1_C3] hypothetical protein AD04_1976 [Escherichia coli 5-172-05_S4_C2] hypothetical protein AC76_4364 [Escherichia coli 5-172-05_S4_C1] hypothetical protein AD20_0279 [Escherichia coli 6-175-07_S4_C2] hypothetical protein AB36_0320 [Escherichia coli 7-233-03_S1_C2] hypothetical protein AC78_0308 [Escherichia coli 7-233-03_S4_C1] hypothetical protein AD35_0293 [Escherichia coli 7-233-03_S4_C3] hypothetical protein AC44_0506 [Escherichia coli 2-177-06_S3_C3] hypothetical protein AD29_0321 [Escherichia coli 2-222-05_S4_C3] FIG00640511: hypothetical protein [Escherichia coli O5:K4(L):H4 str. ATCC 23502] FIG00640511: hypothetical protein [Escherichia coli IS25] Uncharacterised protein [Shigella sonnei] |
1.05e-47 | 100 | 100.000 | WP_001301250 |
hypothetical protein AD21_0379 [Escherichia coli 6-319-05_S4_C2] |
1.17e-47 | 100 | 100.000 | KEM40556 |
Uncharacterised protein [Escherichia coli] |
1.57e-47 | 100 | 100.000 | SQO38066 |
hypothetical protein EcB171_5177 [Escherichia coli B171] Uncharacterised protein [Escherichia coli] Uncharacterised protein [Escherichia coli] Uncharacterised protein [Escherichia coli] |
1.78e-47 | 100 | 100.000 | EDX30691 |
hypothetical protein ECW26_28610 [Escherichia coli W26] |
5.88e-47 | 100 | 98.701 | EID66605 |
hypothetical protein ECDEC13A_0497 [Escherichia coli DEC13A] hypothetical protein ECDEC13D_0395 [Escherichia coli DEC13D] hypothetical protein EC2875000_0326 [Escherichia coli 2875000] hypothetical protein EC2850750_0325 [Escherichia coli 2850750] |
6.16e-47 | 100 | 98.701 | EHX51043 |
hypothetical protein EC2735000_0302 [Escherichia coli 2735000] |
6.47e-47 | 100 | 98.701 | EMZ72615 |
Uncharacterised protein [Escherichia coli] |
1.02e-46 | 100 | 98.701 | STI77602 |
hypothetical protein ECP02994387_0340 [Escherichia coli P0299438.7] |
1.28e-46 | 100 | 97.403 | ENC23466 |
hypothetical protein ECP02994385_0342 [Escherichia coli P0299438.5] |
1.43e-46 | 100 | 97.403 | ENC16675 |
hypothetical protein ECP02994386_0341 [Escherichia coli P0299438.6] |
1.83e-46 | 100 | 97.403 | ENC21720 |
Uncharacterised protein [Escherichia coli] |
2.42e-46 | 100 | 97.403 | STF90886 |
hypothetical protein EAJG_03950 [Escherichia coli E267] |
3e-46 | 100 | 98.701 | OSK43165 |
hypothetical protein [Escherichia coli] |
3.05e-46 | 100 | 98.701 | MGQ66961 |
hypothetical protein [Escherichia coli] hypothetical protein HmCmsJML238_03528 [Escherichia coli] |
3.08e-46 | 100 | 97.403 | WP_097496759 |
hypothetical protein BANRA_02145 [Escherichia coli] hypothetical protein BANRA_01975 [Escherichia coli] hypothetical protein BANRA_03559 [Escherichia coli] |
3.26e-46 | 100 | 97.403 | VCX01607 |
hypothetical protein ECDEC2A_0593 [Escherichia coli DEC2A] |
9.17e-46 | 100 | 96.104 | EHU33308 |
hypothetical protein L282_3187 [Escherichia coli APEC IMT5155] hypothetical protein i01_00449 [Escherichia coli cloneA_i1] |
9.48e-46 | 100 | 96.104 | AJB38146 |
hypothetical protein EC2866450_0324 [Escherichia coli 2866450] |
1.05e-45 | 100 | 97.403 | EMV79675 |
hypothetical protein ECDEC1E_0486 [Escherichia coli DEC1E] |
1.65e-45 | 100 | 96.104 | EHU31534 |
hypothetical protein HmCmsJML282_04379 [Escherichia coli] |
1.99e-45 | 100 | 96.104 | GDE01696 |
hypothetical protein AC00_0329 [Escherichia coli 1-250-04_S3_C1] |
1.78e-44 | 100 | 93.506 | EZJ90058 |
hypothetical protein AC28_0330 [Escherichia coli 1-250-04_S3_C2] |
1.78e-44 | 100 | 93.506 | KEO38811 |
hypothetical protein [Escherichia coli] |
2.4e-44 | 100 | 94.805 | WP_137558264 |
hypothetical protein WEG_02328 [Escherichia coli KTE24] Uncharacterised protein [Escherichia coli] Uncharacterised protein [Escherichia coli] |
2.86e-44 | 100 | 93.506 | EOU73200 |
hypothetical protein [Escherichia coli] hypothetical protein BvCmsJ49A_01173 [Escherichia coli] |
3.27e-44 | 100 | 93.506 | WP_096251413 |
hypothetical protein [Escherichia coli] Uncharacterised protein [Escherichia coli] |
6.56e-44 | 100 | 92.208 | WP_134876962 |
hypothetical protein AB22_0318 [Escherichia coli 6-175-07_S1_C1] |
1.21e-43 | 100 | 94.805 | KEL53357 |
hypothetical protein HmCmsJML125_01308 [Escherichia coli] |
1.71e-43 | 100 | 94.805 | GCZ02870 |
conserved hypothetical protein [Escherichia coli] |
1.6e-42 | 100 | 93.506 | CUX85737 |
hypothetical protein G790_00334 [Escherichia coli HVH 132 (4-6876862)] hypothetical protein G802_00435 [Escherichia coli HVH 144 (4-4451937)] hypothetical protein G870_00382 [Escherichia coli HVH 218 (4-4500903)] hypothetical protein G871_00344 [Escherichia coli HVH 220 (4-5876842)] hypothetical protein G815_00374 [Escherichia coli HVH 157 (4-3406229)] hypothetical protein G817_00382 [Escherichia coli HVH 159 (4-5818141)] |
3.15e-42 | 100 | 93.506 | EQR68705 |
Uncharacterised protein [Escherichia coli] |
1.22e-41 | 88 | 100.000 | STP79317 |
hypothetical protein ECMP02101711_0335 [Escherichia coli MP021017.11] hypothetical protein ECP03052608_0388 [Escherichia coli P0305260.8] hypothetical protein AB11_0343 [Escherichia coli 1-176-05_S1_C1] |
2.55e-36 | 79 | 100.000 | EMV14391 |
hypothetical protein EC1380_02545 [Escherichia coli O145:H28] |
9.82e-36 | 82 | 96.825 | GEE36870 |
hypothetical protein C5P43_34370, partial [Escherichia coli] |
1.96e-24 | 62 | 100.000 | PPZ51141 |
hypothetical protein C5P43_34415, partial [Escherichia coli] |
5.61e-23 | 62 | 95.833 | PPZ51132 |
hypothetical protein, partial [Escherichia coli] |
9.44e-22 | 57 | 100.000 | WP_103722993 |
hypothetical protein EC950083_0389, partial [Escherichia coli 95.0083] |
2.45e-16 | 48 | 100.000 | ELW44631 |
hypothetical protein, partial [Escherichia coli] |
1.82e-15 | 49 | 94.737 | WP_072269172 |
hypothetical protein, partial [Escherichia coli] |
3.09e-13 | 49 | 92.105 | WP_072256231 |
hypothetical protein FIS41_25235, partial [Escherichia coli] |
1.77e-11 | 40 | 100.000 | TPC93789 |
hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] |
3.14e-07 | 34 | 100.000 | WP_157699420 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_300 In ecoli U00096.3
Seq (len = 39 ):
TRPSFTLYGADPAQWFKQTAGAIVVCRYQRQPVKQNGNQ
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|253091|-1|2336117-2336234
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.630784142589857
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_301 In ecoli U00096.3
Seq (len = 69 ):
RKSGDAGCGGHCRQRECHFPFTGKNRPERDWRPVLCSAHQWLAEREGVNRCSAPSGVARTGSDALHPAA
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|245553|-1|2536428-2536635
Transkriptom
89.0% of gene length expressed over median expression of contig.
ŝ
1.8268137315877258
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 8 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} < 2{transkription is high}
Candidate nov_psm6_302 In ecoli U00096.3
Seq (len = 25 ):
MFEINPVNNRIQDLTERSDVLRGYL
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|226852|-1|3036207-3036303
Transkriptom
80.0% of gene length expressed over median expression of contig.
ŝ
3.5636252951025384
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Bordetella pertussis] |
5.71e-16 | 89 | 74.000 | CFP62919 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_303 In ecoli U00096.3
Seq (len = 36 ):
MTTLLPVFTKPSPLALNALRAGRICRFLLIPDGRIR
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|204898|-1|3630667-3630811
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.3359851645989234
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
putative transport protein [Shigella flexneri 5 str. 8401] putative transport protein [Shigella flexneri 5a str. M90T] transport protein [Shigella flexneri] |
1.2e-16 | 100 | 97.059 | ABF03633 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_304 In clostri CP040626.1
Seq (len = 36 ):
INSLTFITTSPICIFRITSNIYLKQIMLFLHYLLIC
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|196622|1|2823909-2824095
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.18111458540599
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_305 In clostri CP040626.1
Seq (len = 20 ):
IPFKSPIPSPLLSLKLLGYI
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|160086|1|2199431-2199506
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.6812412373755872
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_306 In clostri CP040626.1
Seq (len = 20 ):
LLVCTLIGFFLCLGKFIERN
see in UCSC-Genome-Browser
orientation --->
ID:
clostri|CP040626.1|12712|1|172690-172753
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
2.071774894543953
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
pyridoxine kinase [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
pyridoxine kinase [Escherichia coli] |
3.43e-27 | 67 | 100.000 | VEB55119 |
pyridoxine kinase [Escherichia coli] pyridoxine kinase [Escherichia coli] |
4.07e-13 | 51 | 85.714 | STE54057 |
pyridoxine/pyridoxal/pyridoxamine kinase [Escherichia coli] pyridoxine kinase [Escherichia coli] |
6.07e-07 | 41 | 85.714 | WP_151298322 |
Candidate
True candidate
{num(PSMs) > 5} →{ŝ > 3.5} →{no translation on same strand} →{num(unique peptides)} > 2
Candidate nov_psm6_307 In blautia CP039126.1
Seq (len = 57 ):
MNYACVSKQPFITKKDLSVKKPLLAEAKSRREFIRSHDFTVNVDPSTKIAEIKVTKR
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|97988|1|2548109-2548313
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
4.712123655434782
unique PSMS
4
unique PSMS
4
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Chain v, Peptide chain release factor RF2 [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein, partial [Escherichia coli] peptide chain release factor 2 [Escherichia coli str. 'clone D i2'] peptide chain release factor 2 [Escherichia coli str. 'clone D i14'] |
7.53e-09 | 100 | 100.000 | WP_014640427 |
unnamed protein product hypothetical protein [Klebsiella pneumoniae] |
2.44e-08 | 100 | 96.000 | WP_072000084 |
Chain v, Peptide chain release factor RF2 [Escherichia coli] |
8.59e-08 | 100 | 100.000 | 6C4H_v |
Chain v, Peptide chain release factor 2 [Escherichia coli] |
8.76e-08 | 100 | 100.000 | 5U4J_v |
peptide chain release factor 2 [Salmonella enterica subsp. enterica serovar Nchanga str. CFSAN001091] peptide chain release factor 2 [Salmonella enterica subsp. enterica serovar Nchanga str. CFSAN001092] peptide chain release factor 2 [Salmonella enterica subsp. enterica serovar Newport str. SHSN012] |
9.52e-08 | 100 | 92.000 | ESJ29080 |
peptide chain release factor RF-2 [translation factor module pTFM1] |
1.11e-07 | 100 | 100.000 | ALJ52440 |
peptide chain release factor 2 [Escherichia coli] |
1.33e-07 | 100 | 100.000 | WP_097403035 |
peptide chain release factor 2 [Escherichia coli] |
1.33e-07 | 100 | 100.000 | WP_114138736 |
peptide chain release factor 2, partial [Escherichia coli] |
1.36e-07 | 100 | 100.000 | WP_148936025 |
peptide chain release factor 2 [Escherichia albertii] |
1.37e-07 | 100 | 100.000 | WP_113640669 |
RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli HS] peptide chain release factor 2 [Escherichia coli HS] |
1.37e-07 | 100 | 100.000 | A8A432 |
peptide chain release factor 2 [Escherichia coli] |
1.37e-07 | 100 | 100.000 | WP_148722989 |
peptide chain release factor 2 [Escherichia coli] |
1.45e-07 | 100 | 100.000 | MGT38171 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.45e-07 | 100 | 100.000 | WP_104976654 |
peptide chain release factor 2 [Escherichia coli] |
1.45e-07 | 100 | 100.000 | WP_148713440 |
peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_128952530 |
peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_151339005 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_114493136 |
MULTISPECIES: peptide chain release factor 2 [Enterobacteriaceae] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_096179399 |
peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_133142290 |
peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | MSL27241 |
peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_112014132 |
peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_149006123 |
MULTISPECIES: peptide chain release factor 2 [Escherichia] peptide chain release factor 2 [Escherichia coli O25b:H4] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_096489949 |
peptide chain release factor 2 [Escherichia coli] |
1.51e-07 | 100 | 100.000 | WP_113706582 |
MULTISPECIES: peptide chain release factor 2 [Escherichia] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia sp. MOD1-EC6475] |
1.51e-07 | 100 | 100.000 | WP_097680215 |
peptide chain release factor 2 [Citrobacter amalonaticus] peptide chain release factor 2 [Citrobacter amalonaticus] peptide chain release factor 2 [Citrobacter amalonaticus] peptide chain release factor 2 [Citrobacter amalonaticus] peptide chain release factor 2 [Citrobacter amalonaticus] |
1.57e-07 | 100 | 100.000 | WP_103777335 |
peptide chain release factor 2 [Escherichia coli] |
1.57e-07 | 100 | 100.000 | WP_115444335 |
peptide chain release factor 2 [Escherichia coli] |
1.57e-07 | 100 | 100.000 | WP_097477549 |
peptide chain release factor 2 [Escherichia coli] |
1.57e-07 | 100 | 100.000 | WP_113705754 |
peptide chain release factor 2 [Escherichia coli] |
1.57e-07 | 100 | 100.000 | WP_109475678 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.57e-07 | 100 | 100.000 | WP_136757593 |
peptide chain release factor 2 [Kluyvera cryocrescens] |
1.6e-07 | 100 | 100.000 | WP_112204501 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_149007802 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_137566173 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_139245056 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_114078265 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_114433136 |
peptide chain release factor 2 [Kluyvera cryocrescens] |
1.6e-07 | 100 | 100.000 | WP_156315561 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_147716906 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_097735662 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_149025101 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_137496744 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_128972191 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_157229198 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_102203691 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_149010112 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_135279801 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_096951213 |
peptide chain release factor 2 [Escherichia coli] |
1.6e-07 | 100 | 100.000 | WP_137416178 |
MULTISPECIES: peptide chain release factor 2 [Enterobacteriaceae] peptide chain release factor 2 [Citrobacter freundii] peptide chain release factor 2 [Citrobacter gillenii] peptide chain release factor 2 [Citrobacter sp. wls718] peptide chain release factor 2 [Citrobacter sp. TBCS-14] peptide chain release factor 2 [Citrobacter sp. wls613] |
1.6e-07 | 100 | 100.000 | WP_115257544 |
peptide chain release factor 2 [Kluyvera intermedia] peptide chain release factor 2 [Kluyvera intermedia] peptide chain release factor 2 [Kluyvera intermedia] |
1.63e-07 | 100 | 100.000 | WP_153742214 |
peptide chain release factor 2 [Kluyvera ascorbata] peptide chain release factor 2 [Kluyvera ascorbata] |
1.63e-07 | 100 | 100.000 | WP_115073720 |
peptide chain release factor 2 [Escherichia sp. E4742] peptide chain release factor 2 [Escherichia sp. E4742] peptide chain release factor 2 [Escherichia sp. E4742] peptide chain release factor 2 [Escherichia sp. E4742] |
1.63e-07 | 100 | 100.000 | WP_135521124 |
MULTISPECIES: peptide chain release factor 2 [Proteobacteria] peptide chain release factor RF-2 [Escherichia coli O157:H7 str. Sakai] peptide chain release factor 2 [Escherichia coli IAI39] peptide chain release factor RF-2 [Escherichia coli UMN026] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli ATCC 8739] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli SMS-3-5] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli 55989] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia fergusonii ATCC 35469] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli S88] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli ED1a] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli UMN026] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli IAI39] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli O127:H6 str. E2348/69] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli CFT073] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Escherichia coli O157:H7] RecName: Full=Peptide chain release factor 2; Short=RF-2 [Shigella flexneri] peptide chain release factor RF-2 [Shigella flexneri 2a str. 2457T] hypothetical protein ECBD_0846 [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] peptide chain release factor 2 [Escherichia coli B str. REL606] peptide chain release factor RF-2 [Escherichia coli BL21(DE3)] Peptide chain release factor 2 [Escherichia coli KO11FL] Peptide chain release factor 2 [Escherichia coli O157:H7 str. SS17] Peptide chain release factor 2 [Escherichia coli O157:H7 str. SS52] peptide chain release factor 2 [Escherichia coli VR50] peptide chain release factor 2 [Escherichia coli APEC O2-211] peptide chain release factor 2 [Escherichia coli O104:H21 str. CFSAN002236] peptide chain release factor 2 [Escherichia coli M12] peptide chain release factor 2 [Escherichia coli O121:H19] peptide chain release factor 2 [Escherichia coli str. K-12 substr. MG1655] peptide chain release factor 2 [Escherichia coli O157] peptide chain release factor 2 [Escherichia coli O104:H4] peptide chain release factor 2 [Escherichia coli O121 str. RM8352] peptide chain release factor 2 [Escherichia coli O103 str. RM8385] peptide chain release factor 2 [Escherichia coli O26 str. RM8426] peptide chain release factor 2 [Escherichia coli O111 str. RM9322] peptide chain release factor 2 [Escherichia coli O43 str. RM10042] peptide chain release factor 2 [Escherichia coli O26 str. RM10386] peptide chain release factor 2 [Escherichia coli O145 str. RM9872] peptide chain release factor 2 [Shigella flexneri 2a] peptide chain release factor 2 [Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775] peptide chain release factor 2 [Escherichia coli O103] peptide chain release factor 2 [Escherichia coli O26] peptide chain release factor 2 [Escherichia coli O145] peptide chain release factor 2 [Escherichia coli O11] peptide chain release factor 2 [Escherichia coli W] peptide chain release factor 2 [Enterobacteriaceae bacterium TzEc077] peptide chain release factor 2 [Enterobacteriaceae bacterium TzEc058] peptide chain release factor 2 [Enterobacteriaceae bacterium TzEc052] peptide chain release factor 2 [Enterobacteriaceae bacterium TzEc051] peptide chain release factor 2 [Escherichia coli OP50] peptide chain release factor 2 [Escherichia coli O25b:H4-ST131] peptide chain release factor 2 [Enterobacteriaceae bacterium TzEc013] peptide chain release factor 2 [Enterobacteriaceae bacterium 8376wD8] peptide chain release factor 2 [Enterobacteriaceae bacterium 8376wD7] peptide chain release factor 2 [Enterobacteriaceae bacterium 8376wG6] peptide chain release factor 2 [Escherichia sp. HH26CH] peptide chain release factor 2 [Escherichia sp. HH41S] peptide chain release factor 2 [Escherichia coli O18:H1] peptide chain release factor 2 [Shigella flexneri 5a str. M90T] peptide chain release factor 2 [Escherichia coli O113:H21] peptide chain release factor 2 [Escherichia coli O91:H21] peptide chain release factor 2 [Escherichia coli O103:H2] peptide chain release factor 2 [Escherichia coli O111:NM] peptide chain release factor 2 [Escherichia coli O45:H2] peptide chain release factor 2 [Escherichia coli O145:NM] peptide chain release factor 2 [Escherichia coli O26:H11] peptide chain release factor 2 [Escherichia coli O1:H42] peptide chain release factor 2 [Shigella flexneri 1c] peptide chain release factor 2 [Escherichia coli 042] peptide chain release factor 2 [Escherichia coli O80:H26] peptide chain release factor 2 [Escherichia coli O2:H6] peptide chain release factor 2 [Shigella flexneri Y] peptide chain release factor 2 [Escherichia coli O22:H8] peptide chain release factor 2 [Escherichia coli O111:H8] peptide chain release factor 2 [Escherichia coli O111:H-] peptide chain release factor 2 [Escherichia coli K-12] peptide chain release factor 2 [Escherichia coli O25b:H4] peptide chain release factor 2 [Escherichia coli O177] peptide chain release factor 2 (RF-2) [Escherichia coli ETEC H10407] peptide chain release factor RF-2 [Escherichia coli chi7122] peptide chain release factor 2 [Escherichia coli O127:H6] peptide chain release factor RF-2 [Escherichia coli O26:H11 str. 11368] peptide chain release factor RF-2 [Escherichia coli O103:H2 str. 12009] peptide chain release factor RF-2 [Escherichia coli O111:H- str. 11128] peptide chain release factor RF-2 [Escherichia coli O145:H28] peptide chain release factor 2 [Shigella sp.] |
1.65e-07 | 100 | 100.000 | WP_001701073 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_149025037 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_104774101 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_112076015 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_149007613 |
Chain A, peptide chain release factor RF-2 [Escherichia coli K-12] |
1.65e-07 | 100 | 100.000 | 1MI6_A |
MULTISPECIES: peptide chain release factor 2 [Citrobacter] peptide chain release factor 2 [Citrobacter koseri] peptide chain release factor 2 [Citrobacter koseri] peptide chain release factor 2 [Citrobacter koseri] peptide chain release factor 2 [Citrobacter koseri] peptide chain release factor 2 [Citrobacter koseri] |
1.65e-07 | 100 | 100.000 | WP_096753903 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_134269423 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_149006709 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_106377113 |
MULTISPECIES: peptide chain release factor 2 [Escherichia] |
1.65e-07 | 100 | 100.000 | WP_105279452 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor RF-2 [Escherichia coli O157:H7 str. EDL933] |
1.65e-07 | 100 | 100.000 | WP_010904897 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | EAA4590818 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_103856515 |
peptide chain release factor 2 [Shigella flexneri] |
1.65e-07 | 100 | 100.000 | MMO09108 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_149007119 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | RIB40898 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_153275500 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_149007201 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_136770433 |
MULTISPECIES: peptide chain release factor 2 [Citrobacter] peptide chain release factor 2 [Citrobacter werkmanii] peptide chain release factor 2 [Citrobacter sp. wls711] |
1.65e-07 | 100 | 100.000 | WP_096755804 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | MWL13553 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_135386148 |
MULTISPECIES: peptide chain release factor 2 [Escherichia] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_097402380 |
MULTISPECIES: peptide chain release factor 2 [Enterobacteriaceae] |
1.65e-07 | 100 | 100.000 | WP_116585450 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_136750976 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_096194768 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_137412816 |
peptide chain release factor 2 [Citrobacter sp. wls829] peptide chain release factor 2 [Citrobacter sp. wls829] |
1.65e-07 | 100 | 100.000 | WP_137362206 |
MULTISPECIES: peptide chain release factor 2 [Citrobacter] peptide chain release factor 2 [Citrobacter murliniae] |
1.65e-07 | 100 | 100.000 | WP_136345251 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_149006847 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_149006764 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_140429081 |
peptide chain release factor 2 [Shigella flexneri] |
1.65e-07 | 100 | 100.000 | WP_128575895 |
MULTISPECIES: peptide chain release factor 2 [Enterobacteriaceae] peptide chain release factor 2 [Enterobacteriaceae bacterium TzEc058] peptide chain release factor 2 [Citrobacter sp. S39] peptide chain release factor 2 [Citrobacter sp. FDAARGOS_156] peptide chain release factor 2 [Citrobacter freundii] peptide chain release factor 2 [Citrobacter freundii] |
1.65e-07 | 100 | 100.000 | WP_096878465 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_115440585 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | MHU85021 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_137414822 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_102305657 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_109954412 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_136147458 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_135138762 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_130559699 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_130553445 |
peptide chain release factor 2 [Escherichia coli] peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_140421071 |
peptide chain release factor 2 [Escherichia coli] |
1.65e-07 | 100 | 100.000 | WP_148718177 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_308 In blautia CP039126.1
Seq (len = 212 ):
MVNTERVKLTIDGIQIEADRHSTILQAAALAGIRIPTLCYLKDINEIGACRVCVVEVEGYAKLVTACNNRVKEGMVVHTNSPKARKTRRTNVQLILSQHNSNCAYCVRSGNCSLQSVANDLNIMDVPFVRELPKNSWDMDFPLIRDYTKCIKCMRCVQICDKIQSVNVWDVVNTGSRTTVDVSGNRKIDESDCAVCGQCITHCPVGGAQRAG
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|83420|1|2159848-2160502
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6957249495228717
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on SAME strand. Which has 17 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein CSC24_1860 [Escherichia coli] hypothetical protein EC3431_1473 [Escherichia coli 3431] hypothetical protein ECOK1357_3839 [Escherichia coli OK1357] hypothetical protein SFJ1713_4494 [Shigella flexneri SFJ17B] hypothetical protein ECSTECB2F1_3787 [Escherichia coli STEC_B2F1] hypothetical protein EC30301_4034 [Escherichia coli 3030-1] hypothetical protein ECG581_3932 [Escherichia coli G58-1] hypothetical protein ECTX1999_4118 [Escherichia coli TX1999] hypothetical protein ECDEC6B_4489 [Escherichia coli DEC6B] hypothetical protein ECDEC13B_3669 [Escherichia coli DEC13B] hypothetical protein ECDEC14C_4068 [Escherichia coli DEC14C] hypothetical protein ECFRIK1985_4906 [Escherichia coli FRIK1985] hypothetical protein ECPA9_4804 [Escherichia coli PA9] hypothetical protein ECPA10_4947 [Escherichia coli PA10] hypothetical protein ECPA14_4792 [Escherichia coli PA14] hypothetical protein ECEC4422_4699 [Escherichia coli EC4422] hypothetical protein ECEC4448_4681 [Escherichia coli EC4448] hypothetical protein SF285071_4790 [Shigella flexneri 2850-71] hypothetical protein ECFRIK2001_5062 [Escherichia coli FRIK2001] hypothetical protein EC3006_4097 [Escherichia coli 3006] hypothetical protein ECEC1736_4590 [Escherichia coli EC1736] hypothetical protein ECEC1864_4800 [Escherichia coli EC1864] hypothetical protein EC34870_4719 [Escherichia coli 3.4870] hypothetical protein EC80566_3728 [Escherichia coli 8.0566] hypothetical protein EC881467_4729 [Escherichia coli 88.1467] hypothetical protein EC971742_4195 [Escherichia coli 97.1742] hypothetical protein EC990848_4238 [Escherichia coli 99.0848] hypothetical protein EC71982_4276 [Escherichia coli 7.1982] hypothetical protein ECMP0215527_4005 [Escherichia coli MP021552.7] hypothetical protein ECMP0210176_4026 [Escherichia coli MP021017.6] hypothetical protein ECMP0210172_4012 [Escherichia coli MP021017.2] hypothetical protein ECMP02101711_4025 [Escherichia coli MP021017.11] hypothetical protein EC2872800_4018 [Escherichia coli 2872800] hypothetical protein EC2872000_4133 [Escherichia coli 2872000] hypothetical protein EC2871950_4019 [Escherichia coli 2871950] hypothetical protein EC2861200_4023 [Escherichia coli 2861200] hypothetical protein EC2865200_3858 [Escherichia coli 2865200] hypothetical protein EC2845350_4001 [Escherichia coli 2845350] hypothetical protein EC2788150_3820 [Escherichia coli 2788150] hypothetical protein EC2762100_4041 [Escherichia coli 2762100] hypothetical protein EC180050_3849 [Escherichia coli 180050] hypothetical protein ECP03018671_4118 [Escherichia coli P0301867.1] hypothetical protein EC1999001_3717 [Escherichia coli 199900.1] hypothetical protein ECP02994382_3636 [Escherichia coli P0299438.2] hypothetical protein ECP02989421_4062 [Escherichia coli P0298942.1] hypothetical protein ECP03018672_3957 [Escherichia coli P0301867.2] hypothetical protein EC2726950_3912 [Escherichia coli 2726950] hypothetical protein EC2741950_3902 [Escherichia coli 2741950] hypothetical protein EC2730350_3643 [Escherichia coli 2730350] hypothetical protein EC2866350_3891 [Escherichia coli 2866350] hypothetical protein ECMP0215613_3870 [Escherichia coli MP021561.3] hypothetical protein ECP029894211_3917 [Escherichia coli P0298942.11] hypothetical protein ECP029894215_3902 [Escherichia coli P0298942.15] hypothetical protein ECP02989428_3786 [Escherichia coli P0298942.8] hypothetical protein ECP02989429_3562 [Escherichia coli P0298942.9] hypothetical protein ECP02994385_3938 [Escherichia coli P0299438.5] hypothetical protein ECP02999177_3888 [Escherichia coli P0299917.7] hypothetical protein ECP03018678_3780 [Escherichia coli P0301867.8] hypothetical protein ECP03023082_3922 [Escherichia coli P0302308.2] hypothetical protein ECP030529313_3651 [Escherichia coli p0305293.13] hypothetical protein EC2733950_3775 [Escherichia coli 2733950] hypothetical protein ECP02989424_3931 [Escherichia coli P0298942.4] hypothetical protein ECP02994833_3773 [Escherichia coli P0299483.3] hypothetical protein ECP030186713_4038 [Escherichia coli P0301867.13] hypothetical protein ECP03047993_3955 [Escherichia coli P0304799.3] hypothetical protein ECP03022938_3877 [Escherichia coli P0302293.8] hypothetical protein ECP03047775_3664 [Escherichia coli P0304777.5] hypothetical protein ECP030526013_3762 [Escherichia coli P0305260.13] hypothetical protein ECP03052603_3806 [Escherichia coli P0305260.3] hypothetical protein ECP03052604_3726 [Escherichia coli P0305260.4] hypothetical protein ECP03052608_3748 [Escherichia coli P0305260.8] hypothetical protein ECP030529312_3906 [Escherichia coli p0305293.12] hypothetical protein ECP030529315_3890 [Escherichia coli p0305293.15] hypothetical protein ECP03052935_3811 [Escherichia coli p0305293.5] hypothetical protein ECBD561099_4321 [Escherichia coli Bd5610_99] hypothetical protein AD12_1886 [Escherichia coli 1-392-07_S4_C2] hypothetical protein AC27_3528 [Escherichia coli 1-182-04_S3_C2] hypothetical protein AC00_3944 [Escherichia coli 1-250-04_S3_C1] hypothetical protein AB12_3985 [Escherichia coli 1-182-04_S1_C1] hypothetical protein AB40_1613 [Escherichia coli 1-182-04_S1_C2] hypothetical protein AC42_3730 [Escherichia coli 2-052-05_S3_C3] hypothetical protein AB60_3930 [Escherichia coli 2-156-04_S1_C3] hypothetical protein AB01_4019 [Escherichia coli 2-177-06_S1_C1] hypothetical protein AC96_3925 [Escherichia coli 2-156-04_S4_C2] hypothetical protein AD46_3742 [Escherichia coli 6-175-07_S4_C3] hypothetical protein AB68_3684 [Escherichia coli 7-233-03_S1_C3] hypothetical protein AC75_3929 [Escherichia coli 2-474-04_S4_C1] hypothetical protein AB37_3771 [Escherichia coli 8-415-05_S1_C2] |
4.53e-16 | 100 | 100.000 | AWF11670 |
RecName: Full=Protein YhiY [Escherichia coli K-12] hypothetical protein EcSMS35_3777 [Escherichia coli SMS-3-5] hypothetical protein UMNK88_4260 [Escherichia coli UMNK88] hypothetical protein UMNF18_4404 [Escherichia coli UMNF18] hypothetical protein ECRM13514_4466 [Escherichia coli O145:H28 str. RM13514] hypothetical protein ECRM13516_4264 [Escherichia coli O145:H28 str. RM13516] hypothetical protein ECRM12761_20840 [Escherichia coli O145:H28 str. RM12761] hypothetical protein ECRM12581_22040 [Escherichia coli O145:H28 str. RM12581] hypothetical protein L960_3431 [Escherichia coli B7A] hypothetical protein EDL933_4724 [Escherichia coli O157:H7 str. EDL933] hypothetical protein PPECC33_03804 [Escherichia coli PCN033] hypothetical protein J444_3788 [Escherichia coli ACN001] hypothetical protein ACN002_3570 [Escherichia coli] hypothetical protein Ec53638_2390 [Escherichia coli 53638] hypothetical protein ECH7EC4401_0817 [Escherichia coli O157:H7 str. EC4401] hypothetical protein ECH7EC4501_0715 [Escherichia coli O157:H7 str. EC4501] hypothetical protein ECH7EC869_1471 [Escherichia coli O157:H7 str. EC869] hypothetical protein ECH7EC508_1405 [Escherichia coli O157:H7 str. EC508] hypothetical protein EcE22_1863 [Escherichia coli E22] hypothetical protein EcB171_3370 [Escherichia coli B171] hypothetical protein EC1011_5023 [Escherichia coli 101-1] hypothetical protein ESCCO14588_0227 [Escherichia coli O157:H7 str. TW14588] hypothetical protein SDB_01774 [Shigella dysenteriae CDC 74-1112] hypothetical protein SGB_03543 [Shigella boydii ATCC 9905] hypothetical protein SGF_00057 [Shigella flexneri CDC 796-83] hypothetical protein ECoL_03242 [Escherichia coli EC4100B] hypothetical protein ECEPECA14_4020 [Escherichia coli EPECa14] hypothetical protein ECoA_05592 [Escherichia coli O157:H7 str. 1044] conserved hypothetical protein [Escherichia coli H736] conserved hypothetical protein [Escherichia coli M718] conserved hypothetical protein [Escherichia coli TA271] conserved hypothetical protein [Escherichia coli TA280] conserved hypothetical protein [Escherichia coli H591] hypothetical protein SFK218_5220 [Shigella flexneri K-218] hypothetical protein ECSTEC94C_4187 [Escherichia coli STEC_94C] hypothetical protein ECSTECEH250_4185 [Escherichia coli STEC_EH250] hypothetical protein ECSTECMHI813_3846 [Escherichia coli STEC_MHI813] hypothetical protein ECSTECS1191_1085 [Escherichia coli STEC_S1191] hypothetical protein ECDEC3C_4832 [Escherichia coli DEC3C] hypothetical protein ECDEC5E_4303 [Escherichia coli DEC5E] hypothetical protein ECDEC6A_4253 [Escherichia coli DEC6A] hypothetical protein ECDEC6D_4148 [Escherichia coli DEC6D] hypothetical protein ECDEC6E_4122 [Escherichia coli DEC6E] hypothetical protein ECDEC7A_4016 [Escherichia coli DEC7A] hypothetical protein ECDEC7C_4064 [Escherichia coli DEC7C] hypothetical protein ECDEC7D_4272 [Escherichia coli DEC7D] hypothetical protein ECDEC7B_3797 [Escherichia coli DEC7B] hypothetical protein ECDEC7E_3949 [Escherichia coli DEC7E] hypothetical protein ECDEC8D_4684 [Escherichia coli DEC8D] hypothetical protein ECDEC9A_4550 [Escherichia coli DEC9A] hypothetical protein ECDEC9B_4174 [Escherichia coli DEC9B] hypothetical protein ECDEC9D_4168 [Escherichia coli DEC9D] hypothetical protein ECDEC9E_5123 [Escherichia coli DEC9E] hypothetical protein ECDEC10A_4714 [Escherichia coli DEC10A] hypothetical protein ECDEC10D_4499 [Escherichia coli DEC10D] hypothetical protein ECDEC10B_6119 [Escherichia coli DEC10B] hypothetical protein ECDEC11A_4067 [Escherichia coli DEC11A] hypothetical protein ECDEC10F_5091 [Escherichia coli DEC10F] hypothetical protein ECDEC11B_4071 [Escherichia coli DEC11B] hypothetical protein ECDEC11D_4114 [Escherichia coli DEC11D] hypothetical protein ECDEC11C_4398 [Escherichia coli DEC11C] hypothetical protein ECDEC12B_4728 [Escherichia coli DEC12B] hypothetical protein ECDEC12D_4403 [Escherichia coli DEC12D] hypothetical protein ECDEC13A_3823 [Escherichia coli DEC13A] hypothetical protein ECDEC12E_4191 [Escherichia coli DEC12E] hypothetical protein ECDEC13C_4231 [Escherichia coli DEC13C] hypothetical protein ECDEC13D_3949 [Escherichia coli DEC13D] hypothetical protein ECDEC14A_3836 [Escherichia coli DEC14A] hypothetical protein ECDEC15A_4268 [Escherichia coli DEC15A] hypothetical protein ECDEC15D_3921 [Escherichia coli DEC15D] hypothetical protein ECDEC15E_4261 [Escherichia coli DEC15E] hypothetical protein EC970246_1753 [Escherichia coli 97.0246] hypothetical protein EC50588_3848 [Escherichia coli 5.0588] hypothetical protein EC990741_3901 [Escherichia coli 97.0259] hypothetical protein EC12264_1923 [Escherichia coli 1.2264] hypothetical protein EC960497_3859 [Escherichia coli 96.0497] hypothetical protein EC970259_4146 [Escherichia coli 99.0741] hypothetical protein EC96154_3731 [Escherichia coli 96.154] hypothetical protein EC50959_1753 [Escherichia coli 5.0959] hypothetical protein EC90111_2151 [Escherichia coli 9.0111] hypothetical protein EC40967_1626 [Escherichia coli 4.0967] hypothetical protein EC23916_1358 [Escherichia coli 2.3916] hypothetical protein EC33884_1354 [Escherichia coli 3.3884] hypothetical protein EC24168_3807 [Escherichia coli 2.4168] hypothetical protein EC32303_3941 [Escherichia coli 3.2303] hypothetical protein ECB41_3887 [Escherichia coli B41] hypothetical protein EC900105_3763 [Escherichia coli 900105 (10e)] hypothetical protein ECPA42_4807 [Escherichia coli PA42] hypothetical protein ECTW11039_4827 [Escherichia coli TW11039] hypothetical protein ECEC4439_4668 [Escherichia coli EC4439] hypothetical protein SF123566_7019 [Shigella flexneri 1235-66] hypothetical protein ECEPECA12_4122 [Escherichia coli EPECa12] hypothetical protein ECSTECO31_3806 [Escherichia coli STEC_O31] hypothetical protein SSMOSELEY_4512 [Shigella sonnei str. Moseley] hypothetical protein ECPA7_5288 [Escherichia coli PA7] hypothetical protein ECFRIK920_4757 [Escherichia coli FRIK920] hypothetical protein ECTT12B_4551 [Escherichia coli TT12B] hypothetical protein EC5905_4974 [Escherichia coli 5905] hypothetical protein ECN1_3665 [Escherichia coli N1] hypothetical protein ECEC1865_4760 [Escherichia coli EC1865] hypothetical protein ECNE098_4805 [Escherichia coli NE098] hypothetical protein ECFRIK523_4654 [Escherichia coli FRIK523] hypothetical protein ECAD30_40730 [Escherichia coli AD30] hypothetical protein EC82524_4595 [Escherichia coli 8.2524] hypothetical protein EC970003_4311 [Escherichia coli 97.0003] hypothetical protein EC990816_4222 [Escherichia coli 99.0816] hypothetical protein ECPA47_4102 [Escherichia coli PA47] hypothetical protein EC991762_4418 [Escherichia coli 99.1762] hypothetical protein ECMP02155211_3772 [Escherichia coli MP021552.11] hypothetical protein ECMP02155212_4039 [Escherichia coli MP021552.12] hypothetical protein ECMP0210174_3910 [Escherichia coli MP021017.4] hypothetical protein ECMP0210173_4047 [Escherichia coli MP021017.3] hypothetical protein ECMP02101712_3702 [Escherichia coli MP021017.12] hypothetical protein ECC34666_4037 [Escherichia coli C-34666] hypothetical protein ECBCE002MS12_3676 [Escherichia coli BCE002_MS12] hypothetical protein EC2875000_3963 [Escherichia coli 2875000] hypothetical protein ECBCE019MS13_3912 [Escherichia coli BCE019_MS-13] hypothetical protein EC2866550_4041 [Escherichia coli 2866550] hypothetical protein EC2860050_4001 [Escherichia coli 2860050] hypothetical protein EC2851500_3915 [Escherichia coli 2851500] hypothetical protein EC2850750_3965 [Escherichia coli 2850750] hypothetical protein EC2850400_3950 [Escherichia coli 2850400] hypothetical protein EC2845650_3899 [Escherichia coli 2845650] hypothetical protein EC2848050_3906 [Escherichia coli 2848050] hypothetical protein EC2785200_3709 [Escherichia coli 2785200] hypothetical protein EC2780750_3855 [Escherichia coli 2780750] hypothetical protein EC2770900_3847 [Escherichia coli 2770900] hypothetical protein EC2747800_4001 [Escherichia coli 2747800] hypothetical protein EC2731150_4010 [Escherichia coli 2731150] hypothetical protein EC180600_3750 [Escherichia coli 180600] hypothetical protein EC174750_3788 [Escherichia coli 174750] hypothetical protein ECTHROOPD_4416 [Escherichia coli ThroopD] hypothetical protein ECP03047771_3705 [Escherichia coli P0304777.1] hypothetical protein ECP03023081_4387 [Escherichia coli P0302308.1] hypothetical protein ECP03022932_3978 [Escherichia coli P0302293.2] hypothetical protein ECMP0215661_4362 [Escherichia coli MP021566.1] hypothetical protein ECMP0215528_3992 [Escherichia coli MP021552.8] hypothetical protein ECMP0210171_4089 [Escherichia coli MP021017.1] hypothetical protein ECMP0209802_4436 [Escherichia coli MP020980.2] hypothetical protein ECMP0209401_4203 [Escherichia coli MP020940.1] hypothetical protein ECJURUA1811_3813 [Escherichia coli Jurua 18/11] hypothetical protein ECENVIRA101_4269 [Escherichia coli Envira 10/1] hypothetical protein ECENVIRA811_4294 [Escherichia coli Envira 8/11] hypothetical protein EC2726800_4290 [Escherichia coli 2726800] hypothetical protein EC2719100_4166 [Escherichia coli 2719100] hypothetical protein ECBCE001MS16_3835 [Escherichia coli BCE001_MS16] hypothetical protein EC2720900_4129 [Escherichia coli 2720900] hypothetical protein EC2722950_3845 [Escherichia coli 2722950] hypothetical protein ECP03052931_4222 [Escherichia coli p0305293.1] hypothetical protein ECP03052601_3557 [Escherichia coli P0305260.1] hypothetical protein ECP03048161_4198 [Escherichia coli P0304816.1] hypothetical protein ECP02999171_4527 [Escherichia coli P0299917.1] hypothetical protein ECBCE008MS13_4230 [Escherichia coli BCE008_MS-13] hypothetical protein ECBCE007MS11_4074 [Escherichia coli BCE007_MS-11] hypothetical protein ECP03018674_3889 [Escherichia coli P0301867.4] hypothetical protein EC2729250_3942 [Escherichia coli 2729250] hypothetical protein EC180200_3738 [Escherichia coli 180200] hypothetical protein EC2860650_3889 [Escherichia coli 2860650] hypothetical protein EC2864350_3706 [Escherichia coli 2864350] hypothetical protein EC2862600_3888 [Escherichia coli 2862600] hypothetical protein EC2875150_3916 [Escherichia coli 2875150] hypothetical protein ECBCE011MS01_3755 [Escherichia coli BCE011_MS-01] hypothetical protein ECBCE032MS12_3876 [Escherichia coli BCE032_MS-12] hypothetical protein ECP029894210_3816 [Escherichia coli P0298942.10] hypothetical protein ECP029894214_3859 [Escherichia coli P0298942.14] hypothetical protein ECP029894212_3825 [Escherichia coli P0298942.12] hypothetical protein ECP02989426_3862 [Escherichia coli P0298942.6] hypothetical protein ECP02989422_3717 [Escherichia coli P0298942.2] hypothetical protein ECP02989427_3797 [Escherichia coli P0298942.7] hypothetical protein ECP029943811_3861 [Escherichia coli P0299438.11] hypothetical protein ECP02994383_3902 [Escherichia coli P0299438.3] hypothetical protein ECP02994386_3851 [Escherichia coli P0299438.6] hypothetical protein ECP02994387_3974 [Escherichia coli P0299438.7] hypothetical protein ECP02994388_3923 [Escherichia coli P0299438.8] hypothetical protein ECP02994389_3683 [Escherichia coli P0299438.9] hypothetical protein ECP029970676_4074 [Escherichia coli P02997067.6] hypothetical protein ECP029991710_3879 [Escherichia coli P0299917.10] hypothetical protein ECP02999172_3932 [Escherichia coli P0299917.2] hypothetical protein ECP02999173_3640 [Escherichia coli P0299917.3] hypothetical protein ECP02999175_3851 [Escherichia coli P0299917.5] hypothetical protein ECP02999176_3896 [Escherichia coli P0299917.6] hypothetical protein ECP02999178_3909 [Escherichia coli P0299917.8] hypothetical protein ECP02999179_3932 [Escherichia coli P0299917.9] hypothetical protein ECP030186711_3940 [Escherichia coli P0301867.11] hypothetical protein ECP030230810_3838 [Escherichia coli P0302308.10] hypothetical protein ECP030230811_3897 [Escherichia coli P0302308.11] hypothetical protein ECP03023083_3851 [Escherichia coli P0302308.3] hypothetical protein ECP03023085_3903 [Escherichia coli P0302308.5] hypothetical protein ECP03023084_3689 [Escherichia coli P0302308.4] hypothetical protein EC179100_4008 [Escherichia coli 179100] hypothetical protein ECMP0209801_4037 [Escherichia coli MP020980.1] hypothetical protein ECBCE006MS23_3965 [Escherichia coli BCE006_MS-23] hypothetical protein ECP02994832_4026 [Escherichia coli P0299483.2] hypothetical protein ECP03019043_3961 [Escherichia coli P0301904.3] hypothetical protein ECP03022937_3873 [Escherichia coli P0302293.7] hypothetical protein ECP03052602_3808 [Escherichia coli P0305260.2] hypothetical protein ECP030529314_3948 [Escherichia coli p0305293.14] hypothetical protein ECP030229310_3676 [Escherichia coli P0302293.10] hypothetical protein ECP03022933_3778 [Escherichia coli P0302293.3] hypothetical protein ECP03022934_4011 [Escherichia coli P0302293.4] hypothetical protein ECP03022936_3876 [Escherichia coli P0302293.6] hypothetical protein ECP030477710_3766 [Escherichia coli P0304777.10] hypothetical protein ECP03022939_3524 [Escherichia coli P0302293.9] hypothetical protein ECP030477712_3728 [Escherichia coli P0304777.12] hypothetical protein ECP030477713_3761 [Escherichia coli P0304777.13] hypothetical protein ECP030477714_3786 [Escherichia coli P0304777.14] hypothetical protein ECP030477715_3752 [Escherichia coli P0304777.15] hypothetical protein ECP03047772_3691 [Escherichia coli P0304777.2] hypothetical protein ECP03047773_3769 [Escherichia coli P0304777.3] hypothetical protein ECP03047774_3758 [Escherichia coli P0304777.4] hypothetical protein ECP03047777_3767 [Escherichia coli P0304777.7] hypothetical protein ECP03047779_3684 [Escherichia coli P0304777.9] hypothetical protein ECP030481611_3804 [Escherichia coli P0304816.11] hypothetical protein ECP030481610_3863 [Escherichia coli P0304816.10] hypothetical protein ECP030481612_3817 [Escherichia coli P0304816.12] hypothetical protein ECP030481614_3817 [Escherichia coli P0304816.14] hypothetical protein ECP030481613_3791 [Escherichia coli P0304816.13] hypothetical protein ECP030481615_3806 [Escherichia coli P0304816.15] hypothetical protein ECP03048162_3838 [Escherichia coli P0304816.2] hypothetical protein ECP03048166_3738 [Escherichia coli P0304816.6] hypothetical protein ECP03048167_3851 [Escherichia coli P0304816.7] hypothetical protein ECP03048168_3737 [Escherichia coli P0304816.8] hypothetical protein ECP03048169_3793 [Escherichia coli P0304816.9] hypothetical protein ECP030526010_3772 [Escherichia coli P0305260.10] hypothetical protein ECP030526011_3785 [Escherichia coli P0305260.11] hypothetical protein ECP030526012_3755 [Escherichia coli P0305260.12] hypothetical protein ECP030526015_3763 [Escherichia coli P0305260.15] hypothetical protein ECP030529310_3799 [Escherichia coli p0305293.10] hypothetical protein ECP03052609_3717 [Escherichia coli P0305260.9] hypothetical protein ECP030529311_3840 [Escherichia coli p0305293.11] hypothetical protein ECP03052932_3849 [Escherichia coli p0305293.2] hypothetical protein ECP03052933_3884 [Escherichia coli p0305293.3] hypothetical protein ECP03052938_3886 [Escherichia coli p0305293.8] hypothetical protein ECP03052939_3694 [Escherichia coli p0305293.9] hypothetical protein EC178200_3387 [Escherichia coli 178200] hypothetical protein EC178850_3663 [Escherichia coli 178850] hypothetical protein ECP03018673_3968 [Escherichia coli P0301867.3] hypothetical protein ECP03018675_3945 [Escherichia coli P0301867.5] hypothetical protein ECP03018677_3934 [Escherichia coli P0301867.7] hypothetical protein ECP030230813_3704 [Escherichia coli P0302308.13] hypothetical protein ECP030230812_3866 [Escherichia coli P0302308.12] hypothetical protein ECP030230814_3898 [Escherichia coli P0302308.14] hypothetical protein ECP03048163_3866 [Escherichia coli P0304816.3] hypothetical protein ECP03048164_3727 [Escherichia coli P0304816.4] hypothetical protein ECP03048165_3843 [Escherichia coli P0304816.5] hypothetical protein ECP03052937_3895 [Escherichia coli p0305293.7] hypothetical protein L340_0012 [Escherichia coli E2265] hypothetical protein S13_5029 [Escherichia coli B26-2] hypothetical protein QYM_4367 [Escherichia coli B28-2] hypothetical protein QYQ_4333 [Escherichia coli B29-2] hypothetical protein ECT184097_4113 [Escherichia coli T1840_97] hypothetical protein B233_4384 [Escherichia coli 2886-75] hypothetical protein S33_4280 [Escherichia coli B108] hypothetical protein S3G_4508 [Escherichia coli B112] hypothetical protein S3I_4363 [Escherichia coli B113] hypothetical protein S1O_4232 [Escherichia coli B15] hypothetical protein S1K_4343 [Escherichia coli B89] hypothetical protein S1M_4277 [Escherichia coli B90] hypothetical protein L912_0236 [Escherichia coli SCD1] hypothetical protein L341_4805 [Escherichia coli CE418] hypothetical protein L343_3529 [Escherichia coli CE549] hypothetical protein L342_2911 [Escherichia coli CE516] hypothetical protein L339_02658 [Escherichia coli E1777] hypothetical protein AB11_3876 [Escherichia coli 1-176-05_S1_C1] hypothetical protein AB98_4031 [Escherichia coli 1-176-05_S3_C1] hypothetical protein AC55_4261 [Escherichia coli 1-110-08_S3_C3] hypothetical protein AC25_4227 [Escherichia coli 1-110-08_S3_C2] hypothetical protein AB69_3762 [Escherichia coli 1-110-08_S1_C3] hypothetical protein AB97_4281 [Escherichia coli 1-110-08_S3_C1] hypothetical protein AB10_4020 [Escherichia coli 1-110-08_S1_C1] hypothetical protein AB38_3734 [Escherichia coli 1-110-08_S1_C2] hypothetical protein AD11_3848 [Escherichia coli 1-250-04_S4_C2] hypothetical protein AD10_4046 [Escherichia coli 1-182-04_S4_C2] hypothetical protein AC83_3978 [Escherichia coli 1-250-04_S4_C1] hypothetical protein AC82_3794 [Escherichia coli 1-182-04_S4_C1] hypothetical protein AC57_3822 [Escherichia coli 1-392-07_S3_C3] hypothetical protein AC56_3886 [Escherichia coli 1-182-04_S3_C3] hypothetical protein AB99_3849 [Escherichia coli 1-182-04_S3_C1] hypothetical protein AB71_4154 [Escherichia coli 1-182-04_S1_C3] hypothetical protein AB70_3966 [Escherichia coli 1-176-05_S1_C3] hypothetical protein AB53_4016 [Escherichia coli 2-005-03_S1_C3] hypothetical protein AB39_3924 [Escherichia coli 1-176-05_S1_C2] hypothetical protein AB26_3990 [Escherichia coli 2-011-08_S1_C2] hypothetical protein AB25_3995 [Escherichia coli 2-005-03_S1_C2] hypothetical protein AA97_3993 [Escherichia coli 2-005-03_S1_C1] hypothetical protein AA98_3998 [Escherichia coli 2-011-08_S1_C1] hypothetical protein AA99_3997 [Escherichia coli 2-052-05_S1_C1] hypothetical protein AC41_3894 [Escherichia coli 2-011-08_S3_C3] hypothetical protein AB83_4019 [Escherichia coli 2-011-08_S3_C1] hypothetical protein AB54_3775 [Escherichia coli 2-011-08_S1_C3] hypothetical protein AB55_3943 [Escherichia coli 2-052-05_S1_C3] hypothetical protein AB84_1653 [Escherichia coli 2-052-05_S3_C1] hypothetical protein AB17_4288 [Escherichia coli 3-105-05_S1_C1] hypothetical protein AC04_4546 [Escherichia coli 3-105-05_S3_C1] hypothetical protein AC32_4170 [Escherichia coli 3-105-05_S3_C2] hypothetical protein AD43_4905 [Escherichia coli 3-105-05_S4_C3] hypothetical protein AC06_4099 [Escherichia coli 3-373-03_S3_C1] hypothetical protein AC59_4290 [Escherichia coli 3-373-03_S3_C3] hypothetical protein AB47_4913 [Escherichia coli 3-373-03_S1_C2] hypothetical protein AB20_4005 [Escherichia coli 3-475-03_S1_C1] hypothetical protein AC90_4158 [Escherichia coli 3-475-03_S4_C1] hypothetical protein AC87_4365 [Escherichia coli 3-105-05_S4_C1] hypothetical protein AC33_3418 [Escherichia coli 3-267-03_S3_C2] hypothetical protein AC34_4309 [Escherichia coli 3-373-03_S3_C2] hypothetical protein AB18_3794 [Escherichia coli 3-267-03_S1_C1] hypothetical protein AD16_1419 [Escherichia coli 3-267-03_S4_C2] hypothetical protein AD17_4701 [Escherichia coli 3-373-03_S4_C2] hypothetical protein AB77_5027 [Escherichia coli 3-373-03_S1_C3] hypothetical protein AC86_4574 [Escherichia coli 3-073-06_S4_C1] hypothetical protein AB19_4942 [Escherichia coli 3-373-03_S1_C1] hypothetical protein AC89_5100 [Escherichia coli 3-373-03_S4_C1] hypothetical protein AD18_4170 [Escherichia coli 3-475-03_S4_C2] hypothetical protein AB21_3192 [Escherichia coli 4-203-08_S1_C1] hypothetical protein AD45_4384 [Escherichia coli 4-203-08_S4_C3] hypothetical protein AC95_3852 [Escherichia coli 2-052-05_S4_C2] hypothetical protein AD25_3733 [Escherichia coli 2-052-05_S4_C3] hypothetical protein AB85_4034 [Escherichia coli 2-156-04_S3_C1] hypothetical protein AC43_3811 [Escherichia coli 2-156-04_S3_C3] hypothetical protein AB86_3988 [Escherichia coli 2-177-06_S3_C1] hypothetical protein AC68_3827 [Escherichia coli 2-156-04_S4_C1] hypothetical protein AB61_3959 [Escherichia coli 2-177-06_S1_C3] hypothetical protein AB62_3891 [Escherichia coli 2-210-07_S1_C3] hypothetical protein AC29_3448 [Escherichia coli 1-392-07_S3_C2] hypothetical protein AB82_0974 [Escherichia coli 2-005-03_S3_C1] hypothetical protein AC40_1027 [Escherichia coli 2-005-03_S3_C3] hypothetical protein AC65_4499 [Escherichia coli 2-005-03_S4_C1] hypothetical protein AC70_1875 [Escherichia coli 2-210-07_S4_C1] hypothetical protein AB30_4347 [Escherichia coli 2-210-07_S1_C2] hypothetical protein AC01_3881 [Escherichia coli 1-392-07_S3_C1] hypothetical protein AC17_1698 [Escherichia coli 2-210-07_S3_C2] hypothetical protein AD27_1400 [Escherichia coli 2-177-06_S4_C3] hypothetical protein AC45_3265 [Escherichia coli 2-210-07_S3_C3] hypothetical protein AC16_4171 [Escherichia coli 2-177-06_S3_C2] hypothetical protein AB87_3968 [Escherichia coli 2-210-07_S3_C1] hypothetical protein AC98_3499 [Escherichia coli 2-210-07_S4_C2] hypothetical protein AB02_4121 [Escherichia coli 2-222-05_S1_C1] hypothetical protein AB31_4102 [Escherichia coli 2-222-05_S1_C2] hypothetical protein AB63_3111 [Escherichia coli 2-222-05_S1_C3] hypothetical protein AC46_5023 [Escherichia coli 2-222-05_S3_C3] hypothetical protein AC99_4254 [Escherichia coli 2-222-05_S4_C2] hypothetical protein AB89_3982 [Escherichia coli 2-316-03_S3_C1] hypothetical protein AC19_1822 [Escherichia coli 2-316-03_S3_C2] hypothetical protein AC47_1942 [Escherichia coli 2-316-03_S3_C3] hypothetical protein AD00_4561 [Escherichia coli 2-316-03_S4_C2] hypothetical protein AB33_2372 [Escherichia coli 2-427-07_S1_C2] hypothetical protein AC48_2419 [Escherichia coli 2-427-07_S3_C3] hypothetical protein AB90_2763 [Escherichia coli 2-427-07_S3_C1] hypothetical protein AC73_3698 [Escherichia coli 2-427-07_S4_C1] hypothetical protein AB91_5034 [Escherichia coli 2-460-02_S3_C1] hypothetical protein AC20_5009 [Escherichia coli 2-460-02_S3_C2] hypothetical protein AC49_4826 [Escherichia coli 2-460-02_S3_C3] hypothetical protein AD02_3011 [Escherichia coli 2-460-02_S4_C2] hypothetical protein AD32_4778 [Escherichia coli 2-460-02_S4_C3] hypothetical protein AB06_4473 [Escherichia coli 2-474-04_S1_C1] hypothetical protein AB92_1015 [Escherichia coli 2-474-04_S3_C1] hypothetical protein AC21_3769 [Escherichia coli 2-474-04_S3_C2] hypothetical protein AB64_1057 [Escherichia coli 2-427-07_S1_C3] hypothetical protein AB35_3353 [Escherichia coli 2-474-04_S1_C2] hypothetical protein AD03_2143 [Escherichia coli 2-474-04_S4_C2] hypothetical protein AC50_3723 [Escherichia coli 2-474-04_S3_C3] hypothetical protein AD33_0747 [Escherichia coli 2-474-04_S4_C3] hypothetical protein AB15_4311 [Escherichia coli 3-020-07_S1_C1] hypothetical protein AB43_4315 [Escherichia coli 3-020-07_S1_C2] hypothetical protein AB73_4615 [Escherichia coli 3-020-07_S1_C3] hypothetical protein AC02_4554 [Escherichia coli 3-020-07_S3_C1] hypothetical protein AD13_1814 [Escherichia coli 3-020-07_S4_C2] hypothetical protein AD41_1704 [Escherichia coli 3-020-07_S4_C3] hypothetical protein AB44_5091 [Escherichia coli 3-073-06_S1_C2] hypothetical protein AC31_3910 [Escherichia coli 3-073-06_S3_C2] hypothetical protein AC03_3598 [Escherichia coli 3-073-06_S3_C1] hypothetical protein AD14_3354 [Escherichia coli 3-073-06_S4_C2] hypothetical protein AB45_4762 [Escherichia coli 3-105-05_S1_C2] hypothetical protein AD42_3853 [Escherichia coli 3-073-06_S4_C3] hypothetical protein AB75_4398 [Escherichia coli 3-105-05_S1_C3] hypothetical protein AB04_0963 [Escherichia coli 2-427-07_S1_C1] hypothetical protein AD31_4149 [Escherichia coli 2-427-07_S4_C3] hypothetical protein AC74_4156 [Escherichia coli 2-460-02_S4_C1] hypothetical protein AC88_4075 [Escherichia coli 3-267-03_S4_C1] hypothetical protein AC30_4022 [Escherichia coli 3-020-07_S3_C2] hypothetical protein AC07_3435 [Escherichia coli 3-475-03_S3_C1] hypothetical protein AC35_4532 [Escherichia coli 3-475-03_S3_C2] hypothetical protein AB48_1829 [Escherichia coli 3-475-03_S1_C2] hypothetical protein AB49_4756 [Escherichia coli 4-203-08_S1_C2] hypothetical protein AB78_4657 [Escherichia coli 4-203-08_S1_C3] hypothetical protein AC61_3916 [Escherichia coli 4-203-08_S3_C3] hypothetical protein AD19_4411 [Escherichia coli 4-203-08_S4_C2] hypothetical protein AC08_4280 [Escherichia coli 4-203-08_S3_C1] hypothetical protein AC36_2513 [Escherichia coli 4-203-08_S3_C2] hypothetical protein AD44_4758 [Escherichia coli 3-373-03_S4_C3] hypothetical protein AD04_4028 [Escherichia coli 5-172-05_S4_C2] hypothetical protein AC76_4611 [Escherichia coli 5-172-05_S4_C1] hypothetical protein AC51_0383 [Escherichia coli 5-172-05_S3_C3] hypothetical protein AB93_4446 [Escherichia coli 5-172-05_S3_C1] hypothetical protein AB66_4676 [Escherichia coli 5-172-05_S1_C3] hypothetical protein AD34_4502 [Escherichia coli 5-172-05_S4_C3] hypothetical protein AB08_1744 [Escherichia coli 5-366-08_S1_C1] hypothetical protein AC22_1362 [Escherichia coli 5-366-08_S3_C2] hypothetical protein AD20_3676 [Escherichia coli 6-175-07_S4_C2] hypothetical protein AC91_3778 [Escherichia coli 6-175-07_S4_C1] hypothetical protein AB51_3877 [Escherichia coli 6-319-05_S1_C2] hypothetical protein AB80_4026 [Escherichia coli 6-319-05_S1_C3] hypothetical protein AD21_3889 [Escherichia coli 6-319-05_S4_C2] hypothetical protein AD47_3962 [Escherichia coli 6-319-05_S4_C3] hypothetical protein AB36_1575 [Escherichia coli 7-233-03_S1_C2] hypothetical protein AB95_4098 [Escherichia coli 7-233-03_S3_C1] hypothetical protein AC11_3870 [Escherichia coli 6-537-08_S3_C1] hypothetical protein AC64_3889 [Escherichia coli 6-537-08_S3_C3] hypothetical protein AC71_3627 [Escherichia coli 2-222-05_S4_C1] hypothetical protein AC92_3790 [Escherichia coli 6-537-08_S4_C1] hypothetical protein AC53_3858 [Escherichia coli 7-233-03_S3_C3] hypothetical protein AD06_3881 [Escherichia coli 7-233-03_S4_C2] hypothetical protein AC39_3985 [Escherichia coli 6-537-08_S3_C2] hypothetical protein AC23_3986 [Escherichia coli 7-233-03_S3_C2] hypothetical protein AB09_1494 [Escherichia coli 8-415-05_S1_C1] hypothetical protein AC78_3641 [Escherichia coli 7-233-03_S4_C1] hypothetical protein AB52_3894 [Escherichia coli 6-537-08_S1_C2] hypothetical protein AD35_3602 [Escherichia coli 7-233-03_S4_C3] hypothetical protein AB81_3998 [Escherichia coli 6-537-08_S1_C3] hypothetical protein AD22_3791 [Escherichia coli 6-537-08_S4_C2] hypothetical protein AD40_4181 [Escherichia coli 1-392-07_S4_C3] hypothetical protein AC14_3842 [Escherichia coli 2-052-05_S3_C2] hypothetical protein AB88_0612 [Escherichia coli 2-222-05_S3_C1] hypothetical protein AC18_3995 [Escherichia coli 2-222-05_S3_C2] hypothetical protein AC84_3998 [Escherichia coli 1-392-07_S4_C1] hypothetical protein AC44_4238 [Escherichia coli 2-177-06_S3_C3] hypothetical protein AD29_3805 [Escherichia coli 2-222-05_S4_C3] hypothetical protein AC28_5438 [Escherichia coli 1-250-04_S3_C2] hypothetical protein AB05_4109 [Escherichia coli 2-460-02_S1_C1] hypothetical protein EC970264_3913 [Escherichia coli 97.0264] hypothetical protein EAJG_03541 [Escherichia coli E267] hypothetical protein EACG_04119 [Escherichia coli E560] hypothetical protein EAEG_04813 [Escherichia coli B921] hypothetical protein EADG_04084 [Escherichia coli E1114] hypothetical protein ECXG_02309 [Escherichia coli TA447] hypothetical protein ECWG_03367 [Escherichia coli E1002] hypothetical protein ECVG_04808 [Escherichia coli H386] hypothetical protein ECSG_03763 [Escherichia coli B175] hypothetical protein ECQG_03976 [Escherichia coli TA255] hypothetical protein ECRG_02452 [Escherichia coli H617] hypothetical protein EAUG_03428 [Escherichia coli H454] hypothetical protein EASG_02664 [Escherichia coli H383] hypothetical protein EAVG_03221 [Escherichia coli H420] hypothetical protein EAWG_02731 [Escherichia coli TA008] hypothetical protein EBBG_03941 [Escherichia coli E704] hypothetical protein EBAG_03385 [Escherichia coli T426] hypothetical protein ERAG_03673 [Escherichia coli R424] hypothetical protein ECK5_51010 [Escherichia coli O10:K5(L):H4 str. ATCC 23506] hypothetical protein ECK4_42610 [Escherichia coli O5:K4(L):H4 str. ATCC 23502] hypothetical protein [Escherichia coli IS9] hypothetical protein [Klebsiella pneumoniae IS22] hypothetical protein [Escherichia coli IS25] hypothetical protein [Escherichia coli ISC7] |
5.56e-16 | 100 | 100.000 | P0DSG8 |
hypothetical protein EALG_03231 [Escherichia coli TA144] |
6.1e-16 | 100 | 100.000 | OSK22152 |
hypothetical protein ECDEC6C_4166 [Escherichia coli DEC6C] hypothetical protein ECDEC9C_4251 [Escherichia coli DEC9C] hypothetical protein ECDEC10C_5039 [Escherichia coli DEC10C] hypothetical protein ECFDA517_4958 [Escherichia coli FDA517] hypothetical protein ECTW15901_3902 [Escherichia coli TW15901] hypothetical protein ECTW00353_3877 [Escherichia coli TW00353] hypothetical protein EC60172_4828 [Escherichia coli 6.0172] hypothetical protein EC960427_4678 [Escherichia coli 96.0427] hypothetical protein ECMP0210175_3956 [Escherichia coli MP021017.5] hypothetical protein EC2730450_3926 [Escherichia coli 2730450] hypothetical protein ECBCE030MS09_3913 [Escherichia coli BCE030_MS-09] hypothetical protein ECP02989423_4020 [Escherichia coli P0298942.3] hypothetical protein ECP030477711_3748 [Escherichia coli P0304777.11] hypothetical protein ECP03047778_3655 [Escherichia coli P0304777.8] hypothetical protein ECP03052606_3719 [Escherichia coli P0305260.6] hypothetical protein ECP03052936_3699 [Escherichia coli p0305293.6] hypothetical protein AC13_3805 [Escherichia coli 2-011-08_S3_C2] hypothetical protein AB29_4043 [Escherichia coli 2-177-06_S1_C2] hypothetical protein AD26_3723 [Escherichia coli 2-156-04_S4_C3] hypothetical protein AB24_3994 [Escherichia coli 6-537-08_S1_C1] hypothetical protein AB23_3880 [Escherichia coli 6-319-05_S1_C1] hypothetical protein AC77_4164 [Escherichia coli 5-366-08_S4_C1] |
6.86e-16 | 100 | 100.000 | EHV56177 |
hypothetical protein EC2016001_4444 [Escherichia coli 201600.1] hypothetical protein ECP029943810_3870 [Escherichia coli P0299438.10] hypothetical protein ECP02994384_4066 [Escherichia coli P0299438.4] |
1.12e-15 | 100 | 97.222 | ENA18352 |
hypothetical protein AC05_1368 [Escherichia coli 3-267-03_S3_C1] |
2.83e-15 | 100 | 97.222 | KDT66649 |
hypothetical protein AD37_3909 [Escherichia coli 1-110-08_S4_C3] |
3.89e-15 | 100 | 97.222 | EYD94980 |
hypothetical protein CE10_4017 [Escherichia coli O7:K1 str. CE10] hypothetical protein CSC09_4762 [Escherichia coli] conserved hypothetical protein [Escherichia coli TA143] hypothetical protein ECSTECC16502_4274 [Escherichia coli STEC_C165-02] hypothetical protein AB72_3786 [Escherichia coli 1-250-04_S1_C3] hypothetical protein AC12_4252 [Escherichia coli 2-005-03_S3_C2] hypothetical protein AB46_3154 [Escherichia coli 3-267-03_S1_C2] hypothetical protein AB14_4164 [Escherichia coli 1-392-07_S1_C1] hypothetical protein AB42_4121 [Escherichia coli 1-392-07_S1_C2] hypothetical protein AB13_3959 [Escherichia coli 1-250-04_S1_C1] hypothetical protein AB41_2108 [Escherichia coli 1-250-04_S1_C2] hypothetical protein AC72_1679 [Escherichia coli 2-316-03_S4_C1] hypothetical protein AB50_3935 [Escherichia coli 6-175-07_S1_C2] hypothetical protein AB32_4228 [Escherichia coli 2-316-03_S1_C2] hypothetical protein AC52_3133 [Escherichia coli 5-366-08_S3_C3] hypothetical protein AB94_2039 [Escherichia coli 5-366-08_S3_C1] hypothetical protein AB79_4068 [Escherichia coli 6-175-07_S1_C3] hypothetical protein EAMG_04271 [Escherichia coli M056] hypothetical protein ECYG_03408 [Escherichia coli B367] hypothetical protein EAZG_04305 [Escherichia coli TA249] hypothetical protein [Escherichia coli IS1] hypothetical protein [Escherichia coli IS5] |
4.74e-15 | 100 | 97.222 | AEQ14726 |
hypothetical protein AB03_4290 [Escherichia coli 2-316-03_S1_C1] hypothetical protein CSC05_2791 [Escherichia coli] |
4.81e-15 | 100 | 97.222 | KEJ22174 |
hypothetical protein ECP03052605_3698 [Escherichia coli P0305260.5] |
6.04e-15 | 100 | 97.222 | ENG09883 |
hypothetical protein AC80_4244 [Escherichia coli 1-110-08_S4_C1] |
7.53e-15 | 100 | 97.222 | EYD99587 |
hypothetical protein ECMP0215612_4343 [Escherichia coli MP021561.2] |
7.69e-15 | 100 | 97.222 | EMX28741 |
hypothetical protein [Shigella sonnei] hypothetical protein CI734_09300 [Shigella sonnei] |
2.29e-14 | 100 | 91.667 | WP_094338296 |
hypothetical protein ECARS42123_3966 [Escherichia coli ARS4.2123] hypothetical protein AD23_3856 [Escherichia coli 2-005-03_S4_C3] |
2.47e-14 | 100 | 94.444 | EKI23880 |
hypothetical protein AKO63_3740 [Escherichia coli] hypothetical protein HMPREF0358_0230 [Escherichia coli 83972] hypothetical protein ECAA86_03740 [Escherichia coli AA86] conserved hypothetical protein [Escherichia coli M605] conserved hypothetical protein [Escherichia coli TA206] hypothetical protein EC3003_3831 [Escherichia coli 3003] hypothetical protein AC93_3714 [Escherichia coli 2-005-03_S4_C2] hypothetical protein AC67_4003 [Escherichia coli 2-052-05_S4_C1] hypothetical protein AD30_1993 [Escherichia coli 2-316-03_S4_C3] hypothetical protein AD01_2244 [Escherichia coli 2-427-07_S4_C2] hypothetical protein AC79_3818 [Escherichia coli 8-415-05_S4_C1] hypothetical protein AD36_3940 [Escherichia coli 8-415-05_S4_C3] hypothetical protein AB65_1979 [Escherichia coli 2-460-02_S1_C3] hypothetical protein AC54_3913 [Escherichia coli 8-415-05_S3_C3] hypothetical protein AB96_3968 [Escherichia coli 8-415-05_S3_C1] hypothetical protein AB34_4171 [Escherichia coli 2-460-02_S1_C2] hypothetical protein EAHG_03680 [Escherichia coli B671] hypothetical protein ECTG_03140 [Escherichia coli H305] hypothetical protein EAQG_03196 [Escherichia coli TA464] hypothetical protein EARG_03856 [Escherichia coli H461] hypothetical protein EAYG_03988 [Escherichia coli TA014] hypothetical protein [Escherichia coli Nissle 1917] hypothetical protein [Escherichia coli IS29] |
2.94e-14 | 100 | 94.444 | ASO90173 |
hypothetical protein EC958_3886 [Escherichia coli O25b:H4-ST131] |
4.32e-14 | 100 | 94.444 | CDN84232 |
hypothetical protein F9224_10785 [Escherichia coli] |
2.46e-13 | 89 | 100.000 | KAB3053597 |
Uncharacterised protein [Escherichia coli] Uncharacterised protein [Escherichia coli] hypothetical protein BANRA_03411 [Escherichia coli] hypothetical protein BANRA_03251 [Escherichia coli] hypothetical protein BANRA_00242 [Escherichia coli] |
2.8e-10 | 81 | 96.552 | SQL62523 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_309 In blautia CP039126.1
Seq (len = 46 ):
ICKASGRRALTVYTKPGNPVRRTALPAAGELSAQCGALRGRTDRKL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|425040|-1|712749-712890
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8660355213047894
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_310 In blautia CP039126.1
Seq (len = 110 ):
IHGYTHRYPPPLPVFPSPDSEDFQGKDHVLFPHEARSFLPFQSSPKQSVRDSPGCPQSKIQMPGCGSVPRIILRLPHGLNPQKRCRTGPAYLPFPLLYLSLPAYYILPFL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|418314|-1|915432-915903
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.5895039543839262
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_311 In blautia CP039126.1
Seq (len = 122 ):
ISTEFIDDYTLDDFSFVLLKKHHRTDQLRKYAAPVNISHQKHRCLCRFSHSHIDNIFPLQIDLRRTARTFDHYNIILGRQFVISFLNFRYQVLFIGKIFPCTHGPQNLSVYDHLAARLIGGL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|364842|-1|2531303-2531699
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.9681877286696294
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 13 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_312 In blautia CP039126.1
Seq (len = 50 ):
ISWQQALTWESPVFRGGLPISADSTAAISTTMRLRSVLSDGLLSAHSARS
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|274293|-1|4922706-4922859
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.0101054362812265
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 5 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_313 In blautia CP039126.1
Seq (len = 26 ):
IPLLSFALICWLLRRMRSLPRSLRVL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|265016|-1|5164872-5164983
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.6882461389442456
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
2Fe-2S iron-sulfur cluster binding domain-containing protein [Blautia coccoides]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
2Fe-2S iron-sulfur cluster binding domain-containing protein [Blautia coccoides] NADH-quinone oxidoreductase subunit G [Blautia coccoides] NADP-reducing hydrogenase subunit HndC [Blautia coccoides] |
8.97e-147 | 97 | 100.000 | WP_115622969 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Blautia producta] NADP-reducing hydrogenase subunit HndC [Blautia producta] |
1.39e-146 | 97 | 100.000 | WP_130182264 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Clostridiales bacterium VE202-06] |
1.43e-146 | 97 | 100.000 | WP_044953618 |
2Fe-2S iron-sulfur cluster binding domain-containing protein, partial [Blautia producta] hydrogenase, partial [Blautia producta] |
1.71e-143 | 98 | 95.169 | WP_146051806 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Blautia marasmi] |
1.3e-142 | 98 | 96.618 | WP_104805730 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [Blautia] |
1.35e-142 | 98 | 96.618 | WP_095172524 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [Blautia] hydrogenase [Blautia sp. OF01-4LB] hydrogenase [Blautia sp. AF13-16] |
2.67e-140 | 98 | 95.169 | WP_118594048 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Blautia producta] |
3.25e-140 | 98 | 95.169 | WP_033141123 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Lachnoclostridium sp. An131] hydrogenase [Lachnoclostridium sp. An131] |
1.64e-103 | 95 | 71.144 | WP_087164352 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Lachnoclostridium sp. An138] hydrogenase [Lachnoclostridium sp. An138] |
9.7e-103 | 95 | 70.647 | WP_087305315 |
4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium] |
9.96e-103 | 95 | 74.627 | WP_147596979 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [unclassified Blautia] hydrogenase [Blautia sp. An81] hydrogenase [Blautia sp. An46] |
2.3e-100 | 95 | 73.134 | WP_087274300 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Ethanoligenens harbinense] hydrogenase, Fe-only [Ethanoligenens harbinense YUAN-3] hydrogenase [Ethanoligenens harbinense YUAN-3] hydrogenase [Ethanoligenens harbinense] hydrogenase [Ethanoligenens harbinense] 4Fe-4S dicluster domain-containing protein [Ethanoligenens harbinense] |
3.26e-99 | 95 | 68.159 | WP_013486154 |
hydrogenase [Eubacterium sp.] |
2.76e-98 | 95 | 70.149 | HAX58541 |
4Fe-4S dicluster domain-containing protein [Caprobacter fermentans] NADP-reducing hydrogenase subunit HndD [Caprobacter fermentans] |
6.29e-98 | 94 | 71.500 | WP_156990803 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [unclassified Lactonifactor] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Lactonifactor sp. BIOML-A5] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Lactonifactor sp. BIOML-A4] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Lactonifactor sp. BIOML-A3] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Lactonifactor sp. BIOML-A2] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Lactonifactor sp. BIOML-A1] |
7.03e-98 | 95 | 69.652 | WP_154262928 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [Clostridiales] hydrogenase [Lachnospiraceae bacterium OF09-33XD] |
7.34e-98 | 95 | 70.149 | WP_118642563 |
4Fe-4S dicluster domain-containing protein, partial [Lachnospiraceae bacterium VE202-12] |
1.95e-97 | 96 | 66.176 | WP_025494396 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [Robinsoniella] hypothetical protein RHS_0564 [Robinsoniella sp. RHS] NADP-reducing hydrogenase subunit HndC [Robinsoniella peoriensis] |
2.49e-97 | 95 | 71.144 | WP_027293962 |
4Fe-4S dicluster domain-containing protein [Clostridium sp. W14A] hydrogenase [Clostridium sp. W14A] |
3.38e-97 | 94 | 71.000 | WP_066643906 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Peptostreptococcaceae bacterium ZHW00191] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Peptostreptococcaceae bacterium ZHW00191] |
3.44e-97 | 95 | 67.662 | WP_142535152 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Robinsoniella peoriensis] |
3.63e-97 | 95 | 70.647 | WP_070041682 |
putative uncharacterized protein [Firmicutes bacterium CAG:882] |
4.47e-97 | 95 | 69.154 | CDD63882 |
hydrogenase [Lachnoclostridium sp.] |
5.53e-97 | 95 | 68.657 | HAE81696 |
hydrogenase [Eubacterium sp.] hydrogenase [Eubacterium sp.] |
5.92e-97 | 95 | 69.652 | HAR71520 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Oribacterium sp. WCC10] NADH-quinone oxidoreductase subunit G [Oribacterium sp. WCC10] |
7.64e-97 | 95 | 66.667 | WP_091204534 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Caproiciproducens sp. NJN-50] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Caproiciproducens sp. NJN-50] |
1.62e-96 | 95 | 69.652 | WP_128741221 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Oribacterium sp. C9] hydrogenase [Oribacterium sp. C9] |
1.91e-96 | 95 | 67.164 | WP_078036141 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Murimonas intestini] UNVERIFIED_CONTAM: iron-only hydrogenase group A [Murimonas intestini] |
2.01e-96 | 95 | 67.662 | WP_109626078 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Lactonifactor longoviformis] hydrogenase [Lactonifactor longoviformis] NADH-quinone oxidoreductase subunit G [Lactonifactor longoviformis DSM 17459] |
2.02e-96 | 95 | 68.657 | WP_072853482 |
hydrogenase, partial [Massilioclostridium sp.] |
2.31e-96 | 95 | 67.662 | PWM99555 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Oribacterium sp. P6A1] |
3.69e-96 | 95 | 67.662 | WP_036606937 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Clostridium isatidis] hydrogenase [Clostridium isatidis] |
4.36e-96 | 95 | 69.154 | WP_119864257 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Oribacterium sp. NK2B42] |
5.56e-96 | 95 | 67.164 | WP_029201841 |
4Fe-4S dicluster domain-containing protein [Cuneatibacter caecimuris] NADH-quinone oxidoreductase subunit G [Cuneatibacter caecimuris] |
6.27e-96 | 94 | 67.500 | WP_130436009 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [unclassified Oribacterium] NADH-quinone oxidoreductase subunit G [Oribacterium sp. KHPX15] |
7.05e-96 | 95 | 67.164 | WP_031548129 |
MULTISPECIES: 4Fe-4S dicluster domain-containing protein [unclassified Dorea] hydrogenase Fe-only [Dorea sp. CAG:105] 4Fe-4S dicluster domain-containing protein [Dorea sp. AM10-31] 4Fe-4S dicluster domain-containing protein [Dorea sp. AM13-35] 4Fe-4S dicluster domain-containing protein [Dorea sp. AF24-7LB] 4Fe-4S dicluster domain-containing protein [Dorea sp. OM07-5] |
7.28e-96 | 95 | 68.159 | WP_021860950 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Lachnospiraceae bacterium JC7] hydrogenase, Fe-only [Lachnospiraceae bacterium JC7] |
7.29e-96 | 95 | 66.667 | WP_044994793 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Sphaerochaeta coccoides] hydrogenase, Fe-only [Sphaerochaeta coccoides DSM 17374] |
9.75e-96 | 95 | 67.662 | WP_013738980 |
putative uncharacterized protein [Dorea sp. CAG:317] |
1.2e-95 | 95 | 67.662 | CDD07048 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Peptostreptococcus anaerobius] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Peptostreptococcus anaerobius] |
2.37e-95 | 95 | 66.667 | WP_154538651 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Massilioclostridium coli] |
2.6e-95 | 95 | 67.662 | WP_069988234 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Tissierella creatinophila] NADP-reducing hydrogenase subunit HndC [Tissierella creatinophila DSM 6911] |
2.79e-95 | 95 | 67.164 | WP_075727697 |
MULTISPECIES: 4Fe-4S dicluster domain-containing protein [unclassified Peptostreptococcaceae] hydrogenase, Fe-only [[Clostridium] hiranonis DSM 13275] NADP-reducing hydrogenase subunit HndC [[Clostridium] hiranonis] |
3.85e-95 | 95 | 68.657 | WP_006439702 |
4Fe-4S dicluster domain-containing protein [Peptoclostridium sp. AF21-18] 4Fe-4S dicluster domain-containing protein [Peptoclostridium sp. AF21-18] |
4.07e-95 | 95 | 68.657 | WP_118549395 |
4Fe-4S dicluster domain-containing protein [Eisenbergiella tayi] NADP-reducing hydrogenase subunit HndC [Eisenbergiella tayi] hydrogenase [Eisenbergiella tayi] |
5.2e-95 | 95 | 67.662 | WP_069158117 |
hydrogenase [Oribacterium sp.] |
7.88e-95 | 95 | 66.832 | HCS67305 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Eubacterium ramulus] putative ferredoxin hydrogenase HydA1 [Eubacterium ramulus ATCC 29099] |
9.81e-95 | 95 | 69.154 | WP_021739983 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Eubacterium ramulus] Iron hydrogenase 1 [Eubacterium ramulus] |
1.1e-94 | 95 | 69.154 | WP_055289060 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Eubacterium ramulus] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Eubacterium ramulus] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Eubacterium ramulus] 4Fe-4S dicluster domain-containing protein [Eubacterium ramulus] |
1.22e-94 | 95 | 69.154 | WP_129899133 |
4Fe-4S dicluster domain-containing protein [Eisenbergiella sp. OF01-20] 4Fe-4S dicluster domain-containing protein [Eisenbergiella sp. OF01-20] |
1.26e-94 | 95 | 67.164 | WP_118675968 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Eubacterium ramulus] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Eubacterium ramulus] |
1.37e-94 | 95 | 69.154 | WP_154314437 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Peptostreptococcus sp. D1] NADH-quinone oxidoreductase subunit G [Peptostreptococcus sp. D1] |
1.67e-94 | 95 | 65.672 | WP_091993764 |
4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium TF09-5] 4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium TF09-5] |
2.46e-94 | 95 | 67.164 | WP_120152063 |
4Fe-4S dicluster domain-containing protein [Eisenbergiella tayi] [FeFe] hydrogenase, group A [Lachnospiraceae bacterium 3_1_57FAA_CT1] |
2.54e-94 | 95 | 67.164 | WP_009252494 |
MULTISPECIES: 4Fe-4S dicluster domain-containing protein [Clostridiales] NADH-quinone oxidoreductase subunit G [Lachnospiraceae bacterium NLAE-zl-G231] |
2.65e-94 | 95 | 67.164 | WP_044962753 |
MULTISPECIES: 4Fe-4S dicluster domain-containing protein [unclassified Lachnospiraceae] 4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium OM02-31] 4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium OM02-3] |
2.65e-94 | 95 | 67.164 | WP_120092599 |
4Fe-4S dicluster domain-containing protein [Flavonifractor sp. An100] hydrogenase [Flavonifractor sp. An100] |
2.95e-94 | 95 | 67.647 | WP_087396270 |
MULTISPECIES: 4Fe-4S dicluster domain-containing protein [Lachnospiraceae] NADP-reducing hydrogenase subunit HndC [Eisenbergiella tayi] hydrogenase [Eisenbergiella tayi] hydrogenase [Eisenbergiella tayi] hydrogenase [Eisenbergiella tayi] hydrogenase [Eisenbergiella tayi] |
3.51e-94 | 95 | 67.164 | WP_069152578 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Clostridium sp. MSTE9] [FeFe] hydrogenase, group A [Clostridium sp. MSTE9] |
1.17e-93 | 95 | 67.662 | WP_009061668 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] |
1.46e-93 | 95 | 66.169 | WP_028088444 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Clostridium jeddahense] |
1.93e-93 | 95 | 67.164 | WP_042432848 |
4Fe-4S dicluster domain-containing protein [Fretibacterium sp. OH1220_COT-178] 4Fe-4S dicluster domain-containing protein [Fretibacterium sp. OH1220_COT-178] |
1.95e-93 | 95 | 66.169 | WP_124889307 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Keratinibaculum paraultunense] NADH-quinone oxidoreductase subunit G [Keratinibaculum paraultunense] |
2.15e-93 | 95 | 65.672 | WP_132029398 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [unclassified Coprococcus] hypothetical protein HMPREF0987_01660 [Lachnospiraceae bacterium 9_1_43BFAA] [FeFe] hydrogenase, group A [Coprococcus sp. HPP0074] 4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium AM25-17] 4Fe-4S dicluster domain-containing protein [Coprococcus sp. AM27-12LB] |
2.28e-93 | 98 | 66.667 | WP_009263032 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] 4Fe-4S dicluster domain-containing protein [Dorea longicatena] |
2.29e-93 | 95 | 66.169 | WP_118378336 |
4Fe-4S dicluster domain-containing protein, partial [Clostridiales bacterium VE202-27] |
2.39e-93 | 95 | 66.169 | WP_025489827 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Coprococcus sp. AF27-8] 4Fe-4S dicluster domain-containing protein [Coprococcus sp. AF27-8] |
2.4e-93 | 98 | 66.667 | WP_120092494 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Coprococcus sp. AF18-48] 4Fe-4S dicluster domain-containing protein [Coprococcus sp. AF18-48] |
2.48e-93 | 98 | 66.667 | WP_120106196 |
4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium WCA-9-b2] |
2.74e-93 | 95 | 66.667 | MXP74974 |
hydrogenase [Coprococcus sp. 43_8] |
2.82e-93 | 95 | 66.667 | OLA11156 |
MULTISPECIES: 2Fe-2S iron-sulfur cluster binding domain-containing protein [Lachnospiraceae] hypothetical protein HMPREF0490_01838 [Lachnospiraceae bacterium 6_1_37FAA] [FeFe] hydrogenase, group A [Coprococcus sp. HPP0048] 4Fe-4S dicluster domain-containing protein [Coprococcus sp. AM25-15LB] 4Fe-4S dicluster domain-containing protein [Coprococcus sp. AM25-4LB] NADH-quinone oxidoreductase subunit G [Faecalimonas umbilicata] |
2.83e-93 | 98 | 66.667 | WP_008976599 |
4Fe-4S dicluster domain-containing protein [Clostridiales bacterium] Iron hydrogenase 1 [uncultured Flavonifractor sp.] |
2.85e-93 | 95 | 66.176 | WP_147572756 |
Iron hydrogenase 1 [uncultured Flavonifractor sp.] |
3.04e-93 | 95 | 66.176 | SCI59103 |
hydrogenase Fe-only [Roseburia sp. CAG:50] |
3.12e-93 | 95 | 68.657 | CCZ65464 |
Iron hydrogenase 1 [uncultured Clostridium sp.] |
4.2e-93 | 95 | 66.176 | SCH83184 |
4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium KGMB03038] 4Fe-4S dicluster domain-containing protein [Lachnospiraceae bacterium KGMB03038] |
4.36e-93 | 95 | 62.687 | WP_143930608 |
4Fe-4S dicluster domain-containing protein [Eisenbergiella tayi] 4Fe-4S dicluster domain-containing protein [Eisenbergiella tayi] |
4.88e-93 | 95 | 66.169 | WP_154464244 |
MULTISPECIES: 4Fe-4S dicluster domain-containing protein [Clostridiales] putative ferredoxin hydrogenase [Clostridium sp. KLE 1755] 4Fe-4S dicluster domain-containing protein [Eisenbergiella massiliensis] 4Fe-4S dicluster domain-containing protein [Eisenbergiella massiliensis] |
5.15e-93 | 95 | 66.169 | WP_021640195 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] Iron hydrogenase 1 [Dorea longicatena] |
5.61e-93 | 95 | 65.672 | WP_055283735 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] 4Fe-4S dicluster domain-containing protein [Dorea longicatena] |
5.73e-93 | 95 | 65.672 | WP_118309576 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] |
5.92e-93 | 95 | 65.672 | WP_138375762 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Soehngenia sp. 1933P] 2Fe-2S iron-sulfur cluster binding domain-containing protein [Soehngenia sp. 1933P] |
6.17e-93 | 95 | 64.179 | WP_135270463 |
hydrogenase [Ruminococcaceae bacterium AM28-23LB] hydrogenase [Ruminococcaceae bacterium AM28-23LB] |
6.36e-93 | 95 | 66.169 | WP_118746977 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [[Clostridium] ultunense] NADP-reducing hydrogenase subunit HndC [[Clostridium] ultunense Esp] NADP-reducing hydrogenase subunit HndC [[Clostridium] ultunense Esp] |
6.54e-93 | 95 | 66.667 | WP_005583237 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Hathewaya proteolytica] NADH-quinone oxidoreductase subunit G [Hathewaya proteolytica DSM 3090] |
6.73e-93 | 95 | 69.154 | WP_072904086 |
4Fe-4S dicluster domain-containing protein [Eisenbergiella massiliensis] |
7.42e-93 | 95 | 65.672 | WP_102288918 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] 4Fe-4S dicluster domain-containing protein [Dorea longicatena] |
8.92e-93 | 95 | 65.174 | WP_118224675 |
4Fe-4S dicluster domain-containing protein [Clostridium sp. AF36-18BH] 4Fe-4S dicluster domain-containing protein [Clostridium sp. AF36-18BH] |
9.19e-93 | 95 | 65.174 | WP_118505169 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Dorea sp. AF36-15AT] 4Fe-4S dicluster domain-containing protein [Dorea sp. AF36-15AT] |
9.48e-93 | 95 | 65.174 | WP_118452305 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Dorea sp. AM58-8] 4Fe-4S dicluster domain-containing protein [Dorea sp. AM58-8] |
9.68e-93 | 95 | 65.174 | WP_118382858 |
2Fe-2S iron-sulfur cluster binding domain-containing protein [Soehngenia saccharolytica] |
9.95e-93 | 95 | 64.179 | TJX68347 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] |
1.04e-92 | 95 | 65.672 | WP_139009889 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] NADP-reducing hydrogenase subunit HndC [Dorea longicatena] |
1.14e-92 | 95 | 65.672 | WP_144099971 |
Iron hydrogenase 1 [uncultured Ruminococcus sp.] |
1.3e-92 | 95 | 65.174 | SCH63845 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] hydrogenase, Fe-only [Dorea longicatena DSM 13814] 4Fe-4S dicluster domain-containing protein [Dorea longicatena] hydrogenase Fe-only [Dorea longicatena CAG:42] 4Fe-4S dicluster domain-containing protein [Dorea longicatena] |
1.37e-92 | 95 | 65.672 | WP_006427412 |
Iron hydrogenase 1 [uncultured Eubacterium sp.] |
1.54e-92 | 95 | 64.677 | SCH69864 |
4Fe-4S dicluster domain-containing protein [Dorea longicatena] Iron hydrogenase 1 [Dorea longicatena] |
1.8e-92 | 95 | 65.672 | WP_055214640 |
4Fe-4S dicluster domain-containing protein [Clostridium sp. AF34-10BH] 4Fe-4S dicluster domain-containing protein [Clostridium sp. AF34-10BH] |
1.81e-92 | 95 | 64.677 | WP_118539214 |
hydrogenase [Coprococcus comes] Iron hydrogenase 1 [Coprococcus comes] |
1.86e-92 | 95 | 66.169 | WP_055156240 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_314 In blautia CP039126.1
Seq (len = 49 ):
MFLWIWASRRILNENFLISARLFLEPFAGDRSSRKVSSRTWCRRFSTFQ
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|236133|-1|5896323-5896557
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6827029238455213
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_315 In blautia CP039126.1
Seq (len = 36 ):
QGPSGQPAVQSEYLDPSGDHMPGLPCEHYGIHLLPS
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|207831|1|5829965-5830073
Transkriptom
97.0% of gene length expressed over median expression of contig.
ŝ
2.981438187102747
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_316 In blautia CP039126.1
Seq (len = 63 ):
QFCVFLCFAYTHVYNDFVEFRHFHDIFITKLFDHTIYDLIFVYFSQSAHFKMASSLINRLLCL
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|182955|1|5088601-5088790
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.698463622772307
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 39 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
cobinamide kinase [Clostridium sp. CAG:242]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Klebsiella pneumoniae] |
1.02e-13 | 100 | 35.246 | SSK49609 |
Uncharacterised protein [Klebsiella pneumoniae] |
1.36e-13 | 100 | 35.246 | SSN10053 |
cobinamide kinase [Clostridium sp. CAG:242] |
1.36e-13 | 98 | 30.833 | CDA76632 |
Uncharacterised protein [Klebsiella oxytoca] |
1.39e-11 | 100 | 31.967 | SBL51307 |
Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] |
1.41e-09 | 61 | 44.578 | CNU13035 |
Uncharacterised protein [Salmonella enterica subsp. enterica serovar Bovismorbificans] |
5.98e-09 | 61 | 44.578 | CPR42471 |
hypothetical protein PAERUG_P18_London_17_VIM_2_04_10_02072 [Pseudomonas aeruginosa] |
4.29e-07 | 95 | 25.862 | CRO92408 |
hypothetical protein ALP75_204956 [Pseudomonas syringae pv. actinidiae] |
9.49e-07 | 100 | 27.049 | RMS04581 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_317 In blautia CP039126.1
Seq (len = 120 ):
MVAVPDLIKSWAFPSHTSVPWDRPEIRTRSEKDVGLASISICMAKSVPNSGTPRQPKGQPLISSGVIPNASVFLKRDITSLLSRGISLALMPVRSSSIRIIVGSSCPSISSLSRLESMEW
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|176558|1|4889475-4889871
Transkriptom
97.0% of gene length expressed over median expression of contig.
ŝ
2.2192028044056036
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_318 In blautia CP039126.1
Seq (len = 103 ):
HSSLNLSVTMGCSLQKARCPLTGRFPCIEEEKARQPPGFTSPKNETFTCTYLLRCLCSINSAAARTAIFSSVPNAPQTVHRNLCRFHRVLYKKDSTHTCSALL
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|130647|1|3457320-3457629
Transkriptom
87.0% of gene length expressed over median expression of contig.
ŝ
1.6819366650372383
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_319 In bifi AE014295.3
Seq (len = 156 ):
LFDDAGLEPADRVAAHAGTRHQASPDRHPLGRQGHVGAERPESAAHLVRRAEELVYRGHQGRIAAFTRAFPPPRHRGHGLVRFGLQRCEQHGFHACHGVRGRGAWHGSFSFRRLPWHRHHVSSVQDRSRPRGPAGVYDLTFNPRGRLAANPVSCAP
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|8836|1|412743-413337
Transkriptom
21.0% of gene length expressed over median expression of contig.
ŝ
1.8477116556169433
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_320 In bifi AE014295.3
Seq (len = 28 ):
ASPKLVLPEAMTPRIHSRLAGSLRKRLT
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|64016|-1|1655690-1655774
Transkriptom
66.0% of gene length expressed over median expression of contig.
ŝ
1.3729757041656543
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_321 In bifi AE014295.3
Seq (len = 84 ):
VAVTVTSRSASICPLAIVASGSLAAMDSTAAVCEPNAVPLKATVNAPALLFDVAKTPASSPVASAPVSVTVATSCHSSFAEARQ
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|61572|-1|1759372-1759927
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7204851464738142
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [uncultured Blautia sp.] |
9.47e-26 | 98 | 54.237 | SCJ06247 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_322 In bifi AE014295.3
Seq (len = 36 ):
GELGAAGAGAGAGAAGAGAGAAAGVTGGKACVGGTG
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|59375|-1|1850564-1850672
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6973083915490819
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_323 In bifi AE014295.3
Seq (len = 64 ):
MAARSPASLRATTPSRPARATTSTSTPMVVVRSLRAPNGSVRCSNSTASRSRLRPTGRPCATRF
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|36357|1|1657553-1657793
Transkriptom
2.0% of gene length expressed over median expression of contig.
ŝ
1.493494967595128
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_324 In bifi AE014295.3
Seq (len = 120 ):
MRPPPWPTAWARPWTPPVPTSTIRSTRPTPPPTSTTRVISPCGRPPRTPIPRTPVGRRRSAWVALAGTSNAPPCPTVTWAMASTFTAAVWICASPTTKTRWRRPARPATPLLRAGCIRHG
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|26918|1|1225344-1225842
Transkriptom
99.0% of gene length expressed over median expression of contig.
ŝ
1.6277018409227628
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_325 In bifi AE014295.3
Seq (len = 173 ):
LRGAHAEERLGSEHERTHVQRVLAAGRHPVGVALDQRGHGTEEVVNRQLRQVQTLGGVLETLGVRIRAEQPGGAVGMTVSLEALEALLCVVQHGSTRIHLERCVRFDAAVGPTFALGPGHVGHVVGEHLAESRLVDEGLALLIGCGVVVRQYGERFGELVERCRIVVRVFSHY
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|13771|1|634110-635259
Transkriptom
56.99999999999999% of gene length expressed over median expression of contig.
ŝ
2.144278987725311
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_326 In bifi AE014295.3
Seq (len = 90 ):
VLDHRLEGVKRDVRVREAVGQVADEGGLVLGLELGEHSARLAGLVADAQRLAGRRGCFVGHNQKSPLLVQATVLPWVPVTSSAAAWSSVR
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|11368|1|536960-537974
Transkriptom
2.0% of gene length expressed over median expression of contig.
ŝ
1.5461722235521393
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_327 In bact CP040530.1
Seq (len = 19 ):
VYVNDVHLRKRAYSITINK
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|56419|1|1423742-1423826
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.4948952630449877
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_328 In bact CP040530.1
Seq (len = 173 ):
INRGSVSESFHAVGLRQCPIRQSVPYRLLVYGMDENRVADIHRRNHAAIWYILHILQLDLTQAGSRCTVGSFVIERRYLHKVERKFAPAPFRTQVSHKGRHKALVKIGIVTVAFALIPQEASHCKISQRSYLAIVEYTRSGGRILHFSIVIEDGKINATKRLYGFSAHPCLYF
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|50368|1|1284300-1284879
Transkriptom
2.0% of gene length expressed over median expression of contig.
ŝ
1.3413527401518401
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_329 In bact CP040530.1
Seq (len = 138 ):
MLFAPVFIQVVEFPFGILARTHEFPTVFGKECTLIEMLEAQIIMSFTMTGFENRKQTLACHRNDIVSFVFSRISCSSHVYTSSHDVHHMTYLRCHTAYILFNSFRPVRNHRCADSSFIGFGFPKAERCVCHIRPTGTQ
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|446896|-1|1813588-1814005
Transkriptom
8.0% of gene length expressed over median expression of contig.
ŝ
1.9239667065500368
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
trypsin-like serine protease [Rothia mucilaginosa DY-18]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Mycobacterium tuberculosis] |
1.06e-11 | 78 | 36.691 | CNI95083 |
trypsin-like serine protease [Rothia mucilaginosa DY-18] |
1.15e-11 | 79 | 37.589 | BAI64600 |
branched-chain amino acid aminotransferase, partial [Cutibacterium acnes] |
4.12e-10 | 55 | 42.424 | KEY37174 |
Uncharacterised protein [uncultured Blautia sp.] |
1.7e-09 | 62 | 42.991 | SCI89639 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
8.83e-08 | 62 | 39.815 | SKF62199 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_330 In bact CP040530.1
Seq (len = 44 ):
MYYGYLRGSLQQCFPKNGTYIRIRSVYSAGADTYLIDQSRRLIQ
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|435538|-1|2100650-2100944
Transkriptom
18.0% of gene length expressed over median expression of contig.
ŝ
1.6819366650372383
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_331 In bact CP040530.1
Seq (len = 33 ):
KTTSAGTMVSIAKSRTGMLPTRQQAKRGNEYDL
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|419074|-1|2533495-2533594
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.722008988324591
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_332 In bact CP040530.1
Seq (len = 23 ):
STKTMMAVMTKYYQKHIQNHLQV
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|345047|-1|4375231-4375300
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.4916947806366607
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 25 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_333 In bact CP040530.1
Seq (len = 37 ):
INTGMFGKANILRRNQRMNDVGRKIGIAAVYTIIFFH
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|340469|-1|4498870-4499017
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7791077507804807
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 22 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_334 In bact CP040530.1
Seq (len = 36 ):
SASTPSEAVNIRLKYSPSAFFKKSVRSGLSSTTRML
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|291896|-1|5602977-5603085
Transkriptom
69.0% of gene length expressed over median expression of contig.
ŝ
2.0046573581126728
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_335 In bact CP040530.1
Seq (len = 260 ):
MTKRVGSDGEVETQPLCQRLQAVVESSESGLVFTVGSLILPFLITLKNAEKVVGTTGTGRLSVPELVEHLLCAVQNLNAHGSLRLDTIVAQHIAVKSGFLQMRQIGERHPAELEHQSGNSLGTAETIRLGIFIKKPAKSDDRKRPFLTHVHPRIDLMEQAVDIRSTTRLHTPIIDTPKHTHIRGNRIGLQTTFIKVLFVTAKTITGDLTERHTMDTTKLAKRKKGVLIDVRCRIAALLSQTADIDIGTSTKSIFIHYLHH
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|239211|1|5626639-5627419
Transkriptom
77.0% of gene length expressed over median expression of contig.
ŝ
1.3665315444204134
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_336 In bact CP040530.1
Seq (len = 41 ):
MDGYEHAVHYRPESWKTADFRIVGHSPEGSRQPVVGDCHSG
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|132380|1|3133506-3133701
Transkriptom
18.0% of gene length expressed over median expression of contig.
ŝ
2.342944147142896
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{overlap with annotation}
Candidate nov_psm6_337 In anaero CP036345.1
Seq (len = 69 ):
MAAADPAAVTAETPRTALLWAVPEKDAASPVSFAMGKDAMEKALSARDSTNPQERIKRFPLPISLRAPP
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|74450|1|1835708-1835981
Transkriptom
21.0% of gene length expressed over median expression of contig.
ŝ
2.907162436623068
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_338 In anaero CP036345.1
Seq (len = 41 ):
MHQRIYSDTQRKDICHRHGTSESEGIPVEVPKRVYKRETGT
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|38436|1|913621-913825
Transkriptom
87.0% of gene length expressed over median expression of contig.
ŝ
1.9676499026171137
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_339 In anaero CP036345.1
Seq (len = 45 ):
MPSRAPASITKALWPHSPAFSRNSSSKLKSSRKSPLSIVFMILLS
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|107485|1|2773953-2774112
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7463389790532733
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_340 In anaero CP036345.1
Seq (len = 50 ):
MASSCVRISSSGNNALASAGLKYGSRCRQTGPYSSSSLMAGNSSLNVPST
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|101121|1|2586028-2586196
Transkriptom
12.0% of gene length expressed over median expression of contig.
ŝ
1.7439239896130927
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Bacteroides thetaiotaomicron] |
1.04e-108 | 61 | 99.371 | CUN23780 |
hypothetical protein HMPREF2534_02547, partial [Bacteroides thetaiotaomicron] |
1.39e-62 | 40 | 94.286 | KXT37307 |
hypothetical protein HMPREF2534_04245, partial [Bacteroides thetaiotaomicron] |
4.24e-51 | 40 | 82.692 | KXT31781 |
hypothetical protein HMPREF2534_02859, partial [Bacteroides thetaiotaomicron] |
3.57e-38 | 32 | 83.133 | KXT36491 |
hypothetical protein BACOVA_00005, partial [Bacteroides ovatus ATCC 8483] |
1.34e-07 | 23 | 45.000 | EDO14281 |
hypothetical protein BXY_15800 [Bacteroides xylanisolvens XB1A] |
1.63e-06 | 21 | 46.429 | CBK66701 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_341 In lacto CP039121.1
Seq (len = 20 ):
LDMLTSILMPNSLCVIRASS
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|46516|1|834432-834498
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.642065152999546
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein HMPREF2534_04009 [Bacteroides thetaiotaomicron] |
1.18e-32 | 100 | 98.214 | KXT32542 |
MULTISPECIES: hypothetical protein [Bacteroides] hypothetical protein DW640_11950 [Bacteroides sp. AM23-12] hypothetical protein DWW05_10750 [Bacteroides thetaiotaomicron] hypothetical protein DW991_16380 [Bacteroides thetaiotaomicron] hypothetical protein DW697_12995 [Bacteroides thetaiotaomicron] hypothetical protein DW011_19450 [Bacteroides thetaiotaomicron] |
2.52e-32 | 100 | 98.214 | WP_117578222 |
conserved hypothetical protein [Bacteroides sp. 1_1_14] |
4.75e-32 | 100 | 96.429 | EFI03726 |
hypothetical protein [Bacteroides fragilis] hypothetical protein DXB57_10930 [Bacteroides fragilis] hypothetical protein DXA67_23040 [Bacteroides fragilis] |
1.46e-18 | 89 | 72.000 | WP_122200301 |
hypothetical protein HMPREF1203_00263 [Bacteroides fragilis HMW 610] |
1.54e-18 | 89 | 72.000 | EKA92147 |
hypothetical protein HMPREF1181_02037 [Bacteroides stercoris CC31F] |
2.8e-16 | 89 | 62.000 | EPH20084 |
hypothetical protein [Bacteroides finegoldii] |
3.37e-16 | 89 | 62.000 | WP_032839661 |
hypothetical protein [Bacteroides stercoris] |
3.55e-16 | 89 | 62.000 | WP_051146089 |
hypothetical protein BACFIN_07423 [Bacteroides finegoldii DSM 17565] |
4.5e-16 | 89 | 62.000 | EEX44802 |
hypothetical protein [Bacteroides fragilis] hypothetical protein BUN20_07450 [Bacteroides fragilis] |
9.23e-16 | 80 | 73.333 | WP_101603119 |
MULTISPECIES: hypothetical protein [unclassified Bacteroides] hypothetical protein DWW63_07330 [Bacteroides sp. AF16-29] hypothetical protein DWW34_06225 [Bacteroides sp. AF15-23LB] |
2.36e-14 | 89 | 60.000 | WP_120066912 |
hypothetical protein [Bacteroides fragilis] hypothetical protein BFAG_01749 [Bacteroides fragilis 3_1_12] hypothetical protein AOQ65_09300 [Bacteroides fragilis] hypothetical protein AE749_17945 [Bacteroides fragilis] |
3.55e-14 | 77 | 72.093 | WP_005777434 |
hypothetical protein [Lachnospiraceae bacterium YSB2008] |
8.61e-11 | 89 | 54.000 | WP_027118109 |
hypothetical protein [Eubacterium uniforme] hypothetical protein SAMN02745111_01206 [Eubacterium uniforme] |
2.65e-10 | 89 | 52.000 | WP_078766078 |
hypothetical protein [Gilliamella apicola] hypothetical protein DKK70_09995 [Gilliamella apicola] |
3.05e-09 | 89 | 48.000 | WP_110433868 |
hypothetical protein [Ruminococcus flavefaciens] |
3.24e-09 | 89 | 46.000 | WP_100218914 |
hypothetical protein [Ruminococcus flavefaciens] hypothetical protein RF007C_08445 [Ruminococcus flavefaciens 007c] |
8.01e-09 | 89 | 44.000 | WP_037301061 |
hypothetical protein [Clostridium botulinum] |
9.78e-09 | 88 | 40.816 | WP_061313637 |
hypothetical protein [Clostridium uliginosum] hypothetical protein SAMN05421842_14030 [Clostridium uliginosum] |
2.01e-08 | 88 | 42.857 | WP_090094324 |
hypothetical protein [Absiella sp. AM29-15] hypothetical protein DW761_16740 [Absiella sp. AM29-15] |
2.08e-08 | 89 | 48.000 | WP_117518826 |
MULTISPECIES: hypothetical protein [unclassified Absiella] hypothetical protein DW271_13810 [Absiella sp. AM22-9] hypothetical protein DW120_15420 [Absiella sp. AM10-20] hypothetical protein DW113_04640 [Absiella sp. AM09-45] hypothetical protein DW114_01185 [Absiella sp. AM09-50] hypothetical protein DXA09_12055 [Absiella sp. AM54-8XD] |
3.04e-08 | 89 | 48.000 | WP_117451587 |
hypothetical protein [Lachnospiraceae bacterium G41] hypothetical protein SAMN04487760_1063 [Lachnospiraceae bacterium G41] |
4.31e-08 | 88 | 46.939 | WP_089992853 |
hypothetical protein [Clostridium botulinum] hypothetical protein KU40_13425 [Clostridium botulinum] |
5.25e-08 | 88 | 40.816 | WP_035792746 |
hypothetical protein [Ruminococcaceae bacterium KH2T8] hypothetical protein SAMN05216413_0491 [Ruminococcaceae bacterium KH2T8] |
4.56e-07 | 88 | 48.980 | WP_093122568 |
hypothetical protein [Ruminococcaceae bacterium AE2021] |
2.38e-06 | 89 | 44.000 | WP_051601979 |
MULTISPECIES: hypothetical protein [Clostridia] |
4.23e-06 | 86 | 39.583 | WP_029472172 |
hypothetical protein MSKU15_3523 [Komagataeibacter diospyri] |
4.83e-06 | 93 | 44.231 | GCE91922 |
hypothetical protein DBX92_07765, partial [Dielma fastidiosa] |
6.35e-06 | 86 | 39.583 | PWM58854 |
hypothetical protein [Dielma fastidiosa] |
7.71e-06 | 86 | 39.583 | HAH92712 |
hypothetical protein [Dielma fastidiosa] hypothetical protein DWZ33_07320 [Dielma fastidiosa] |
7.71e-06 | 86 | 39.583 | WP_118454343 |
hypothetical protein [Ruminococcus flavefaciens] |
7.86e-06 | 89 | 42.000 | WP_009987456 |
hypothetical protein [Dielma fastidiosa] hypothetical protein DES51_107186 [Dielma fastidiosa] |
8.14e-06 | 86 | 39.583 | WP_022939149 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_342 In lacto CP039121.1
Seq (len = 50 ):
MLLTIGPHSEKAAAPRVGLSACNILNTDGNIACGLLKSAKYSCPMVALVP
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|306305|-1|617747-617966
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.6736641390712486
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_343 In lacto CP039121.1
Seq (len = 141 ):
LLASAPVNGSARLVTAVVMVGASAVGMLAVFPVSVRVWLAVVASVRSFATDELVVSVFSTSVSALVVAVLVADADVASVLVDLLVTLGALALAPSVLDMLALESALLEAVPTSAAGFVAAVDWRLLEAEVAPVESVVALVS
see in UCSC-Genome-Browser
orientation <---
ID:
lacto|CP039121.1|260609|-1|1537659-1538196
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.9520764476828167
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_344 In lacto CP039121.1
Seq (len = 21 ):
ICVTNPDFPSPVLSWDAPDRQ
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|164789|1|3139743-3139866
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.063151282971601
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_345 In lacto CP039121.1
Seq (len = 18 ):
VSSKIAPTKDSTSNKINE
see in UCSC-Genome-Browser
orientation --->
ID:
lacto|CP039121.1|151825|1|2881274-2881388
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.4461169733561254
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_346 In ery NZ_CP036346.1
Seq (len = 19 ):
LIKLLLQQEQEWQLKKLEK
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|418|1|5432-5516
Transkriptom
88.0% of gene length expressed over median expression of contig.
ŝ
1.9329291439546297
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_347 In ery NZ_CP036346.1
Seq (len = 23 ):
INASNSSCVICKALKSTQTRYNP
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|408581|-1|370594-370786
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
2.03511209557871
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_348 In ery NZ_CP036346.1
Seq (len = 61 ):
MFFWFFIYINIIFISSFKQQLIDIIFCSNSSLVFVLSGNSIFKAIVINPKKNIFFNSIITY
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|403680|-1|449592-449778
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9112734360461445
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein Nizo2029_2905 [Lactobacillus plantarum] |
1.77e-81 | 100 | 100.000 | KZT84377 |
hypothetical protein N654_2323 [Lactobacillus plantarum 4_3] |
5.44e-53 | 87 | 97.541 | ETF11134 |
hypothetical protein SF2A35B_0305 [Lactobacillus plantarum] |
2.81e-24 | 74 | 77.885 | KTF03295 |
hypothetical protein FBR4_0758 [Lactobacillus plantarum] |
2.67e-23 | 43 | 93.443 | KZE00941 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_349 In ery NZ_CP036346.1
Seq (len = 31 ):
YTSFASANSTNKLAHLSKIIKEFAVFKAPLI
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|365624|-1|1048040-1048133
Transkriptom
98.0% of gene length expressed over median expression of contig.
ŝ
1.645891560852599
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_350 In ery NZ_CP036346.1
Seq (len = 16 ):
QKLVLVNMREQKLKRI
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|363072|-1|1088552-1088600
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6338884766216528
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 6 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_351 In ery NZ_CP036346.1
Seq (len = 12 ):
SLNYDGQGPYYL
see in UCSC-Genome-Browser
orientation <---
ID:
ery|NZ_CP036346.1|341042|-1|1440580-1440616
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6478174818886373
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_352 In ery NZ_CP036346.1
Seq (len = 17 ):
MLVKLSLLMNMVIMIKK
see in UCSC-Genome-Browser
orientation --->
ID:
ery|NZ_CP036346.1|156233|1|2293418-2293496
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.4357285695614372
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_353 In ecoli U00096.3
Seq (len = 35 ):
RFAPHHWSCSAQEGNVGEKGVTRAQIALNPAGRLA
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|81505|1|2185195-2185300
Transkriptom
36.0% of gene length expressed over median expression of contig.
ŝ
1.544140432796464
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_354 In ecoli U00096.3
Seq (len = 26 ):
MARMRPTCAPTPVMMSFASRSPRNAA
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|62445|1|1667485-1667659
Transkriptom
97.0% of gene length expressed over median expression of contig.
ŝ
1.950781977329818
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_355 In ecoli U00096.3
Seq (len = 102 ):
LQLPDWVLMPPGVAMVCHVSTIKHWPDWHSSTRLSFCFVMLNVATVQPINACQIKQVLRLKVPRMPVNWATLLVLISLISIFIPVIPSGPFSRLPGFQRVKN
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|252023|-1|2365250-2365592
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7366796097698962
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_356 In ecoli U00096.3
Seq (len = 16 ):
IDTDHSIKIVVIAKAI
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|232122|-1|2900905-2900977
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7787596886645525
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_357 In ecoli U00096.3
Seq (len = 72 ):
VTGNNASRGGESVVMDGRWGVVVKILSNVRGAKAPSCSTSVTCRKSPAIAISLTTPLEPVQNLQKTLQEKAK
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|174019|-1|4500790-4501048
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.526269795831116
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_358 In ecoli U00096.3
Seq (len = 41 ):
LWRGRAFSCLCAPFAENSSHLVRCLCPGGRSQPRNTCGQRC
see in UCSC-Genome-Browser
orientation <---
ID:
ecoli|U00096.3|170075|-1|4606966-4607104
Transkriptom
74.0% of gene length expressed over median expression of contig.
ŝ
1.8106032741647815
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 8 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_359 In ecoli U00096.3
Seq (len = 23 ):
MPFAFDHRRDFFAYLHNFLRMMT
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|16318|1|443849-443924
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.5569979284289384
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_360 In ecoli U00096.3
Seq (len = 31 ):
VCYKTRYYPHSPCAVAPQKRFNANATSHHHA
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|131246|1|3618496-3618610
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.6055483191737834
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 4 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_361 In ecoli U00096.3
Seq (len = 71 ):
ISLAQSNHQRMVGDSYSKRIKAARQPARCCRRRGKDKGDRTWPAGKNGFTLHVSQHGVINIGFKLLVICCD
see in UCSC-Genome-Browser
orientation --->
ID:
ecoli|U00096.3|124963|1|3430899-3431235
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7375489102695703
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
phosphoglycerate mutase [Escherichia coli]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
phosphoglycerate mutase [Escherichia coli] |
5.93e-47 | 86 | 88.636 | STI73331 |
Protein induced by aluminum [Escherichia coli] |
3.47e-26 | 70 | 71.831 | STI84871 |
hypothetical protein CRJUMX02_1830019 [Escherichia coli] |
5.58e-10 | 34 | 88.571 | VEW03335 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_362 In clostri CP040627.1
Seq (len = 44 ):
TFKYILDNPMQVEINKIRMLILLLIARKTAEAANDDAVCPEGNE
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040627.1|55101|-1|704733-704865
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.5219147171777205
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_363 In clostri CP040626.1
Seq (len = 18 ):
LDFQLFHLHLVVLFQNSF
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|488444|-1|626618-626732
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.721246399047171
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
group II intron reverse transcriptase/maturase [Enterobacter cloacae]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
MULTISPECIES: hypothetical protein [Escherichia] hypothetical protein CO715_13460 [Escherichia coli M12] hypothetical protein CXP41_23295 [Escherichia coli str. K-12 substr. MG1655] hypothetical protein [Salmonella enterica subsp. enterica serovar Oranienburg] hypothetical protein HMPREF1613_05296 [Escherichia coli 908616] hypothetical protein HMPREF1612_04600 [Escherichia coli 908585] hypothetical protein HMPREF1617_02120 [Escherichia coli 908675] hypothetical protein BFR92_21370 [Acinetobacter pittii] hypothetical protein CI767_08070 [Shigella boydii] hypothetical protein DBP04_15885 [Escherichia sp. R8] hypothetical protein [Shigella sp.] |
8.17e-44 | 100 | 100.000 | WP_023148767 |
hypothetical protein HMPREF9348_00062 [Escherichia coli MS 145-7] |
2.8e-43 | 100 | 98.611 | EFO60461 |
hypothetical protein [Escherichia coli] |
4.15e-43 | 100 | 98.611 | WP_071781575 |
MULTISPECIES: hypothetical protein [Escherichia] hypothetical protein APECO78_02330 [Escherichia coli APEC O78] hypothetical protein J444_4662 [Escherichia coli ACN001] hypothetical protein [Shigella boydii] hypothetical protein [Salmonella enterica] hypothetical protein BW76_06550 [Escherichia coli O28ac:NM str. 02-3404] hypothetical protein BFF48_21970 [Shigella sp. FC1882] hypothetical protein BHQ35_22100 [Shigella sp. FC2175] hypothetical protein BHQ33_21865 [Shigella sp. FC2125] hypothetical protein CI731_23070 [Shigella sonnei] |
4.53e-43 | 100 | 98.611 | WP_000116357 |
hypothetical protein C5P35_15900 [Escherichia coli] |
4.68e-43 | 100 | 98.611 | PPZ24783 |
hypothetical protein BEA19_22800 [Escherichia coli] |
6.51e-43 | 100 | 98.611 | RCO96310 |
hypothetical protein AWP60_04685 [Escherichia coli] |
8.47e-43 | 100 | 98.611 | OKV80894 |
hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein C5P33_24150 [Escherichia coli] |
1.48e-42 | 100 | 97.222 | WP_097546941 |
hypothetical protein [Escherichia coli] hypothetical protein PU76_14450 [Escherichia coli] |
1.66e-42 | 100 | 97.222 | EAC1324164 |
hypothetical protein BMT62_06870 [Escherichia coli] hypothetical protein B7D90_10505 [Escherichia coli] |
1.93e-42 | 100 | 97.222 | OOI45931 |
hypothetical protein [Escherichia coli] |
2.74e-42 | 100 | 98.611 | WP_071998869 |
hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] hypothetical protein [Escherichia coli] |
2.01e-40 | 100 | 94.444 | WP_024247394 |
hypothetical protein HMPREF1601_01287 [Escherichia coli 907779] hypothetical protein HMPREF1596_01238 [Escherichia coli 907700] hypothetical protein HMPREF1597_00358 [Escherichia coli 907701] hypothetical protein HMPREF1607_00404 [Escherichia coli 908524] hypothetical protein HMPREF1614_01799 [Escherichia coli 908624] hypothetical protein HMPREF1615_02199 [Escherichia coli 908632] hypothetical protein HMPREF1618_01420 [Escherichia coli 908691] hypothetical protein V413_08165 [Escherichia coli LAU-EC8] hypothetical protein V412_14905 [Escherichia coli LAU-EC7] hypothetical protein V414_08710 [Escherichia coli LAU-EC9] |
4.69e-40 | 100 | 94.444 | ESA91886 |
MULTISPECIES: hypothetical protein [Escherichia] hypothetical protein P423_23750 [Escherichia coli JJ1886] hypothetical protein AX202_24470 [Escherichia coli JJ1887] hypothetical protein ECHM605_02681 [Escherichia coli HM605] hypothetical protein BY60_08695 [Escherichia coli O15:H18 str. K1516] hypothetical protein CR63_24915 [Escherichia coli NB8] hypothetical protein ECNA114_015620 [Escherichia coli NA114] hypothetical protein UG58_07980 [Escherichia coli O25b:H4-ST131] hypothetical protein CI768_04855 [Shigella sonnei] hypothetical protein CEG97_08425 [Shigella flexneri] |
6.23e-40 | 100 | 94.444 | WP_001145303 |
hypothetical protein [Escherichia coli] hypothetical protein CIG17_05190 [Escherichia coli] |
9.15e-40 | 100 | 93.056 | WP_113383198 |
hypothetical protein BFD58_21460 [Escherichia coli] |
2.23e-39 | 100 | 93.056 | ROK77547 |
hypothetical protein [Escherichia coli] |
1.3e-38 | 100 | 93.056 | WP_024191743 |
hypothetical protein BI322_29290 [Klebsiella oxytoca] |
9.83e-19 | 79 | 82.456 | OQR47606 |
group II intron reverse transcriptase/maturase [Enterobacter cloacae] group II intron reverse transcriptase/maturase [Enterobacter cloacae] |
9.98e-19 | 74 | 86.792 | WP_111968021 |
hypothetical protein [Salmonella enterica subsp. enterica serovar Carrau] hypothetical protein [Salmonella enterica subsp. enterica serovar Carrau] |
1.03e-18 | 74 | 86.792 | ECT8080651 |
hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica subsp. enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] |
1.12e-18 | 74 | 86.792 | EAA2616306 |
hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] |
1.12e-18 | 74 | 86.792 | EAM2930525 |
hypothetical protein [Salmonella enterica] |
1.12e-18 | 74 | 86.792 | EBI7663541 |
group II intron reverse transcriptase/maturase [Salmonella enterica] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. enterica] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. enterica serovar Newport] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. enterica serovar Infantis] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. enterica serovar Poona] group II intron reverse transcriptase/maturase [Salmonella enterica] |
2.2e-18 | 74 | 86.792 | WP_079920182 |
group II intron reverse transcriptase/maturase [Salmonella enterica] |
2.27e-18 | 74 | 86.792 | EDC2643339 |
group II intron reverse transcriptase/maturase [Salmonella enterica] |
2.64e-18 | 74 | 86.792 | ECG8813496 |
group II intron reverse transcriptase/maturase [Salmonella enterica] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. enterica] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. diarizonae] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. diarizonae str. CFSAN000553] group II intron reverse transcriptase/maturase [Salmonella enterica subsp. enterica serovar Enteritidis] hypothetical protein SED60170_01182 [Salmonella enterica subsp. diarizonae serovar 60:r:e,n,x,z15 str. 01-0170] |
2.82e-18 | 74 | 86.792 | WP_023245793 |
group II intron reverse transcriptase/maturase [Trabulsiella odontotermitis] |
5.8e-18 | 74 | 84.906 | WP_080993443 |
hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica subsp. enterica serovar Sundsvall] hypothetical protein [Salmonella enterica] |
2.45e-16 | 69 | 84.000 | EBB3834012 |
hypothetical protein [Salmonella enterica] |
2.45e-16 | 69 | 84.000 | EBH5934835 |
hypothetical protein [Salmonella enterica] |
2.69e-16 | 69 | 84.000 | EBT3691936 |
hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] |
2.75e-16 | 69 | 84.000 | EAZ8977394 |
hypothetical protein [Salmonella enterica] |
2.75e-16 | 69 | 84.000 | EAT2222415 |
hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] hypothetical protein [Salmonella enterica] |
2.89e-16 | 69 | 84.000 | EAX9515233 |
hypothetical protein [Klebsiella oxytoca] |
3.16e-16 | 67 | 85.417 | WP_139791823 |
group II intron reverse transcriptase/maturase [Enterobacter sp. 18A13] |
9.58e-16 | 74 | 81.132 | WP_143345844 |
group II intron reverse transcriptase/maturase [Klebsiella oxytoca] |
1.69e-15 | 67 | 85.417 | WP_155005807 |
group II intron reverse transcriptase/maturase [Klebsiella sp. TOUT106] group II intron reverse transcriptase/maturase [Klebsiella sp. TOUT106] |
1.73e-15 | 67 | 85.417 | WP_138363269 |
group II intron reverse transcriptase/maturase [Salmonella enterica subsp. enterica serovar Newport] |
2.06e-15 | 67 | 85.417 | ECN6753433 |
group II intron reverse transcriptase/maturase [Salmonella enterica] |
2.49e-15 | 67 | 85.417 | ECC5394806 |
group II intron reverse transcriptase/maturase [Enterobacter sp. 18A13] |
4.12e-14 | 69 | 80.000 | WP_143345835 |
hypothetical protein [Escherichia coli] |
1.52e-13 | 65 | 74.468 | WP_149038923 |
group II intron reverse transcriptase/maturase [Janthinobacterium sp. FT58W] group II intron reverse transcriptase/maturase [Janthinobacterium sp. FT58W] |
3.48e-07 | 74 | 54.717 | WP_152248445 |
group II intron reverse transcriptase/maturase [Azotobacter beijerinckii] |
1.49e-06 | 74 | 52.830 | WP_090735209 |
group II intron reverse transcriptase/maturase [Azotobacter salinestris] |
5.37e-06 | 63 | 55.556 | WP_152390185 |
group II intron reverse transcriptase/maturase [Azotobacter chroococcum] group II intron reverse transcriptase/maturase [Azotobacter chroococcum] |
5.7e-06 | 63 | 55.556 | WP_131302574 |
group II intron reverse transcriptase/maturase [Azotobacter beijerinckii] group II intron reverse transcriptase/maturase [Azotobacter beijerinckii] group II intron reverse transcriptase/maturase [Azotobacter beijerinckii] |
5.81e-06 | 63 | 55.556 | WP_090941767 |
group II intron reverse transcriptase/maturase [Rubrivivax gelatinosus] |
8.43e-06 | 63 | 57.778 | WP_081487419 |
group II intron reverse transcriptase/maturase [Azotobacter chroococcum] group II intron reverse transcriptase/maturase [Azotobacter chroococcum] |
8.51e-06 | 63 | 55.556 | WP_136888311 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_364 In clostri CP040626.1
Seq (len = 103 ):
MPFTSTFPLVGVKIPVIIFIVVDFPAPFEPIYPTTSPSSISKFILSTALVTVYSVENKDFIAPLNPGYFLFVLNSLVKLHTLIKNINSYTGRLIKHIFMHNLY
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|486729|-1|653808-654180
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.7695510786217257
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_365 In clostri CP040626.1
Seq (len = 18 ):
MNLKLRFLLHLCNTIYLH
see in UCSC-Genome-Browser
orientation <---
ID:
clostri|CP040626.1|422867|-1|1728889-1728973
Transkriptom
0% of gene length expressed over median expression of contig.
ŝ
1.6975247634618378
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_366 In blautia CP039126.1
Seq (len = 14 ):
INPFWKKPAGMWKS
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|415102|-1|1010229-1010313
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.5142785735184199
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 28 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
nickel import ATP-binding protein NikE [Shigella boydii]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
nickel import ATP-binding protein NikE [Shigella boydii] |
1.32e-06 | 74 | 91.304 | WP_151349593 |
nickel import ATP-binding protein NikE [Shigella boydii] |
1.99e-06 | 74 | 91.304 | WP_134804792 |
Nickel transport ATP-binding protein NikE (TC 3.A.1.5.3) [Escherichia coli ISC41] |
3.93e-06 | 65 | 100.000 | CDL47937 |
nickel-responsive transcriptional regulator NikR [Escherichia coli M056] |
6.43e-06 | 74 | 82.609 | OSK20264 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_367 In blautia CP039126.1
Seq (len = 46 ):
MLKLCFLQILSHIHLDGRGCVNGYIHGYRLGHDHGHIDQSKNIQPF
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|399825|-1|1464977-1465124
Transkriptom
97.0% of gene length expressed over median expression of contig.
ŝ
2.0502848009161543
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_368 In blautia CP039126.1
Seq (len = 21 ):
MISIAWSAVASSASSGCHIRL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|379968|-1|2056193-2056292
Transkriptom
71.0% of gene length expressed over median expression of contig.
ŝ
1.8545963923160942
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_369 In blautia CP039126.1
Seq (len = 34 ):
KTSTNASYTAILTGQRHWRVCSPSSPPVKQKTRP
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|369915|-1|2367208-2367310
Transkriptom
27.0% of gene length expressed over median expression of contig.
ŝ
1.5906305295471803
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_370 In blautia CP039126.1
Seq (len = 22 ):
ISPYAGLKSHSLYGRSRKIGKS
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|367486|-1|2444220-2444322
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.4989407377822483
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein RBG13Loki_3621 [Candidatus Lokiarchaeota archaeon CR_4] |
1.78e-06 | 52 | 51.852 | OLS12789 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_371 In blautia CP039126.1
Seq (len = 54 ):
MWQTGNTMGNCPFRYTASWMSGPTWHCPMTSISCWQPCGRAQFPAVSSFRTLPR
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|349457|-1|2974285-2974477
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8724632826717913
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_372 In blautia CP039126.1
Seq (len = 56 ):
LRKETTTAAPCRKSSLWLRARKCAWYSCWVRGTGKPLIPTGKNTAILQMWMQPMRN
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|307678|-1|4049788-4049965
Transkriptom
56.00000000000001% of gene length expressed over median expression of contig.
ŝ
1.8143634230380883
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_373 In blautia CP039126.1
Seq (len = 16 ):
YQNVQAVMTFFVTNFL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|305731|-1|4100317-4100365
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.2289026935295877
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_374 In blautia CP039126.1
Seq (len = 65 ):
IKAGGYVRNHHQGHGNGKDVQGTGASRETHPSSESSFCRMRPVLVYRGSGKRENGENDAGAGNPV
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|299455|-1|4258218-4258509
Transkriptom
80.0% of gene length expressed over median expression of contig.
ŝ
1.9968267947166558
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_375 In blautia CP039126.1
Seq (len = 57 ):
IGDGSRFPPLHTSPLSLPAVPAERERFYTGKIWAGGIYPGFCHMAEPATGTGAIPVQ
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|277624|-1|4830008-4830215
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8733275505826992
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_376 In blautia CP039126.1
Seq (len = 18 ):
LDLPLLCMTVPQTAMRKM
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|276643|-1|4854538-4854595
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.8783307479565472
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{no overlap with annotation}
Candidate nov_psm6_377 In blautia CP039126.1
Seq (len = 179 ):
MEQLRPVSKLEKILFPIVITILVCMILPTTAPLVGMLMLGNLFRESGVVKQLTETASNALMYIVVILLGTSVGASTSAEAFLNADTLKIVALGLVAFAVGTAGGVLFGKIMCKMSGGKINPLIGSAGVSAIPMAARVSQKVGAEADPTNFLLMHAMGPNVAGVIGTAVAAGTFMAVFGV
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|235690|-1|5908128-5908698
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.9508724647729836
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_378 In blautia CP039126.1
Seq (len = 40 ):
EKTGSDPGKYPAGSIGDAADLQDGKGKYSFKGFAGCKGFL
see in UCSC-Genome-Browser
orientation <---
ID:
blautia|CP039126.1|234648|-1|5933409-5933529
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.7304870557820835
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_379 In blautia CP039126.1
Seq (len = 143 ):
LHDQTYTCNPGPAAGPHKNRLPACFNELHHIGVQPDGSHCHDNEELAQCLQRIEDSRRNTQVHSDGGDHRSPHKIQDKEGKYFSELNVISFLLFQILCPYNGKYKGDGNDGQSPGQLHGHSFVKCGGAQIVKGIPGGCSSGHR
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|192399|1|5377825-5378335
Transkriptom
86.0% of gene length expressed over median expression of contig.
ŝ
1.928854709548917
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on SAME strand. Which has 2 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_380 In blautia CP039126.1
Seq (len = 136 ):
ISRHVNAAPVIQGGMKNRNRIILRHIDFIQNSKTAELCAPVYTAFAQLHLIIDKCVCTDQITAVSINMKRNIVYRPAEDPGQILRQHIFPCSFRACQKQVLPFQKGSDSHFQNFSAIKRHIRTDDTPFSLLRHIIF
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|182384|1|5071257-5072235
Transkriptom
35.0% of gene length expressed over median expression of contig.
ŝ
1.8396315252071516
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_381 In blautia CP039126.1
Seq (len = 57 ):
PPSLVKLSLRLFSVQSACPSSTPIKDQVPELMYKALSSFDGTAKTAEPVSWVAGRIT
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|181149|1|5031514-5031685
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.658895361105707
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_382 In blautia CP039126.1
Seq (len = 134 ):
MVINPLCHITFVIETFYKFCCLYRSIFIHGNFAAILIDQRSSSHLEIRCPPYTIRVISVVCQRNNRSSLRDDCFDLVTDRIEIVFTGNIKLTLVIQRNACLLQDIFVEVHDLRMSIQGNCIDGTVKGYGFHGGL
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|137169|1|3659113-3659872
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7465812182425429
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_383 In blautia CP039126.1
Seq (len = 192 ):
MEISKNTCTTSGIPNGHTPPTACPVLASASWGESIFAFVWKCSLYFLLSTLASPAITTRTAVPSTKKDRVFAMRSGPHPAASAASSTVAEDCENSMIRSSMPKPLKYSFTFSIAISAPLFYRPSFSIHSFSLNPVTTKDSPTSTGRFTSIPSVASRSSCCSSLISGSFSFRFSSLYFIPLVLKKRFRGRPLA
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|129471|1|3417424-3418192
Transkriptom
94.0% of gene length expressed over median expression of contig.
ŝ
1.4903495204534174
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 3 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
oxaloacetate decarboxylase beta subunit [Firmicutes bacterium CAG:646]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
oxaloacetate decarboxylase beta subunit [Firmicutes bacterium CAG:646] |
1.19e-114 | 100 | 96.648 | CCZ36005 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. SG-772] sodium ion-translocating decarboxylase subunit beta [Blautia sp. SG-772] |
2.3e-114 | 100 | 96.648 | WP_106492286 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Blautia] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium BSM-380-WT-5A] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AM16-16B] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AM22-22LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF25-12LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF22-5LB] |
8.72e-114 | 100 | 96.089 | WP_117523449 |
oxaloacetate decarboxylase beta subunit [Blautia sp. CAG:52] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
2.09e-113 | 100 | 95.531 | CDB20066 |
oxaloacetate decarboxylase beta subunit [Roseburia sp. CAG:471] |
2.18e-113 | 100 | 95.531 | CDD99407 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcaceae bacterium] sodium ion-translocating decarboxylase beta subunit [Firmicutes bacterium CAG:56] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] |
3.06e-113 | 100 | 93.855 | WP_022118819 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
1.16e-112 | 100 | 93.296 | HCS84827 |
Na+-transporting oxaloacetate decarboxylase beta subunit, partial [uncultured bacterium] |
1.89e-112 | 100 | 92.179 | AMP56197 |
sodium ion-translocating decarboxylase subunit beta [Marvinbryantia formatexigens] sodium ion-translocating decarboxylase, beta subunit [Marvinbryantia formatexigens DSM 14469] oxaloacetate decarboxylase, beta subunit [Marvinbryantia formatexigens] |
8.47e-112 | 100 | 93.296 | WP_006864634 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Lactonifactor] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A5] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A4] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A3] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A2] sodium ion-translocating decarboxylase subunit beta [Lactonifactor sp. BIOML-A1] |
1.05e-111 | 100 | 93.296 | WP_154258577 |
sodium ion-translocating decarboxylase subunit beta [Lactonifactor longoviformis] sodium ion-translocating decarboxylase subunit beta [Lactonifactor longoviformis] oxaloacetate decarboxylase, beta subunit [Lactonifactor longoviformis DSM 17459] |
1.94e-111 | 100 | 93.296 | WP_072850840 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Blautia] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. YL58] sodium ion-translocating decarboxylase subunit beta [Blautia coccoides] |
5.19e-111 | 100 | 92.737 | WP_065541542 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Blautia] |
5.24e-111 | 100 | 92.737 | WP_095172847 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. An249] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. An249] |
5.48e-111 | 100 | 93.296 | WP_087220623 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Blautia] sodium ion-translocating decarboxylase subunit beta [Blautia producta] sodium ion-translocating decarboxylase subunit beta [Blautia sp. OF01-4LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF13-16] |
5.78e-111 | 100 | 92.737 | WP_033141761 |
sodium ion-translocating decarboxylase subunit beta [Blautia producta] |
5.98e-111 | 100 | 92.737 | WP_018597973 |
sodium ion-translocating decarboxylase subunit beta [Blautia hansenii] sodium ion-translocating decarboxylase beta subunit [Blautia sp. CAG:257] |
7.05e-111 | 100 | 93.296 | WP_022067383 |
Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] |
7.2e-111 | 100 | 92.737 | SCG89099 |
sodium ion-translocating decarboxylase subunit beta [Blautia producta] Glutaconyl-CoA decarboxylase subunit beta [Blautia producta] |
8.47e-111 | 100 | 92.179 | WP_130181983 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. OF03-15BH] sodium ion-translocating decarboxylase subunit beta [Blautia sp. OF03-15BH] |
9.26e-111 | 100 | 92.737 | WP_117765880 |
sodium ion-translocating decarboxylase subunit beta [Blautia coccoides] oxaloacetate decarboxylase beta subunit [Blautia coccoides] sodium ion-translocating decarboxylase, beta subunit [Blautia coccoides] |
9.35e-111 | 100 | 92.179 | WP_029468781 |
sodium ion-translocating decarboxylase subunit beta [Anaerotruncus sp. 1XD22-93] sodium ion-translocating decarboxylase subunit beta [Anaerotruncus sp. 1XD22-93] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] |
2.64e-110 | 100 | 92.737 | WP_120483964 |
sodium ion-translocating decarboxylase subunit beta [Acetatifactor muris] Glutaconyl-CoA decarboxylase subunit beta [Acetatifactor muris] |
3.91e-110 | 100 | 92.179 | WP_103238043 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Blautia] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. An81] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. An46] |
4.41e-110 | 100 | 92.737 | WP_087272041 |
sodium ion-translocating decarboxylase subunit beta [Anaerostipes hadrus] glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus DSM 3319] Glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus] Glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus] sodium ion-translocating decarboxylase subunit beta [Anaerostipes hadrus] |
5.93e-110 | 100 | 92.737 | WP_009203339 |
sodium ion-translocating decarboxylase subunit beta [Anaerostipes hadrus] Glutaconyl-CoA decarboxylase subunit beta [Anaerostipes hadrus] |
5.99e-110 | 100 | 92.737 | WP_055073070 |
Glutaconyl-CoA decarboxylase subunit beta [Dorea longicatena] |
6.11e-110 | 100 | 87.709 | CUQ37808 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
6.18e-110 | 100 | 91.620 | HCT90844 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium OF09-6] |
7.21e-110 | 100 | 91.061 | WP_117448989 |
Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] |
7.62e-110 | 100 | 91.061 | SCH81733 |
sodium ion-translocating decarboxylase subunit beta [Blautia schinkii] |
9.27e-110 | 100 | 92.179 | WP_044948117 |
sodium ion-translocating decarboxylase subunit beta [Cuneatibacter caecimuris] oxaloacetate decarboxylase beta subunit [Cuneatibacter caecimuris] |
1.88e-109 | 100 | 89.944 | WP_130434534 |
sodium ion-translocating decarboxylase subunit beta [bacterium 1XD42-54] sodium ion-translocating decarboxylase subunit beta [bacterium 1XD42-54] |
1.99e-109 | 100 | 91.061 | WP_120391700 |
sodium ion-translocating decarboxylase subunit beta [Blautia obeum] Glutaconyl-CoA decarboxylase subunit beta [Blautia obeum] |
2.13e-109 | 100 | 91.620 | WP_144369498 |
sodium ion-translocating decarboxylase subunit beta [Blautia hansenii] sodium ion-translocating decarboxylase subunit beta [Blautia hansenii DSM 20583] hypothetical protein HMPREF0992_01863 [Lachnospiraceae bacterium 6_1_63FAA] putative uncharacterized protein [Lachnospiraceae bacterium CAG:364] |
2.7e-109 | 100 | 91.061 | WP_009247240 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Lachnospiraceae] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-22] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-11LB] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-40] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM25-39] |
2.79e-109 | 100 | 90.503 | WP_117467933 |
sodium ion-translocating decarboxylase subunit beta [Murimonas intestini] |
2.85e-109 | 100 | 91.061 | WP_148408996 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. Marseille-P3201T] |
2.95e-109 | 100 | 91.061 | WP_072449421 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase, beta subunit [Blautia obeum ATCC 29174] sodium ion-translocating decarboxylase, beta subunit [Blautia obeum A2-162] sodium ion-translocating decarboxylase beta subunit [Ruminococcus obeum CAG:39] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] sodium ion-translocating decarboxylase subunit beta [Blautia obeum] |
2.98e-109 | 100 | 91.620 | WP_005424527 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium WCA3-601-WT-6H] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium WCA3-601-WT-6H] |
3.01e-109 | 100 | 91.620 | WP_154495202 |
Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
3.15e-109 | 100 | 91.620 | SCH94434 |
sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium AM59-13] sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium AM59-13] |
3.32e-109 | 100 | 91.620 | WP_118546229 |
sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium OM08-11AC] sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium OM08-11AC] |
3.55e-109 | 100 | 91.620 | WP_118691954 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Firmicutes sensu stricto (miscellaneous)] glutaconyl-CoA decarboxylase subunit beta [Firmicutes bacterium CAG:65_45_313] Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium AF22-6AC] glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
3.63e-109 | 100 | 91.620 | WP_118550305 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
3.92e-109 | 100 | 92.179 | WP_158420340 |
sodium ion-translocating decarboxylase subunit beta [Eubacteriaceae bacterium] Glutaconyl-CoA decarboxylase subunit beta [uncultured Eubacterium sp.] |
3.96e-109 | 100 | 92.179 | WP_147606316 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] hypothetical protein HMPREF9474_01760 [ [[Clostridium] symbiosum WAL-14163] sodium ion-translocating decarboxylase, beta subunit [[Clostridium] symbiosum WAL-14673] glutaconyl-CoA decarboxylase subunit beta [[Clostridium] symbiosum ATCC 14940] Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] hypothetical protein HMPREF1020_01024 [Clostridium sp. 7_3_54FAA] |
4.66e-109 | 100 | 89.944 | WP_003510703 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] |
4.81e-109 | 100 | 90.503 | WP_158440414 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM42-11] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM42-11] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
5.15e-109 | 100 | 91.061 | WP_118578037 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcaceae bacterium] Glutaconyl-CoA decarboxylase subunit beta [[Ruminococcus] torques] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] |
5.15e-109 | 100 | 91.061 | WP_148461987 |
sodium ion-translocating decarboxylase subunit beta [Blautia hansenii] |
5.38e-109 | 100 | 91.061 | WP_040351047 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Firmicutes sensu stricto (miscellaneous)] sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium AM10-47] sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium OM04-13BH] oxaloacetate decarboxylase beta subunit [Firmicutes bacterium CAG:227] |
5.67e-109 | 100 | 90.503 | WP_022303500 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Clostridiaceae bacterium OM08-6BH] |
6.13e-109 | 100 | 88.827 | WP_118769391 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Dorea] sodium ion-translocating decarboxylase subunit beta [Dorea sp. AM58-8] sodium ion-translocating decarboxylase subunit beta [Dorea sp. AF36-15AT] Glutaconyl-CoA decarboxylase subunit beta [uncultured Eubacterium sp.] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] |
7.29e-109 | 100 | 89.385 | WP_118382628 |
sodium ion-translocating decarboxylase subunit beta [Lachnoclostridium sp. An196] glutaconyl-CoA decarboxylase subunit beta [Lachnoclostridium sp. An196] |
7.87e-109 | 100 | 88.827 | WP_087154178 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae] sodium ion-translocating decarboxylase, beta subunit [Tyzzerella nexilis DSM 1787] putative uncharacterized protein [Clostridium nexile CAG:348] sodium ion-translocating decarboxylase subunit beta [Clostridium sp.] sodium ion-translocating decarboxylase subunit beta [Tyzzerella nexilis] sodium ion-translocating decarboxylase subunit beta [Tyzzerella nexilis] |
9.27e-109 | 100 | 90.503 | WP_004613806 |
glutaconyl-CoA decarboxylase subunit beta [Blautia hansenii DSM 20583] |
9.88e-109 | 100 | 91.061 | EEX22662 |
sodium ion-translocating decarboxylase subunit beta [Blautia glucerasea] |
1.09e-108 | 100 | 91.620 | WP_156353369 |
sodium ion-translocating decarboxylase subunit beta [Clostridium sp. OM02-18AC] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. OM02-18AC] |
1.13e-108 | 100 | 89.944 | WP_118708174 |
putative uncharacterized protein [Clostridium sp. CAG:91] |
1.14e-108 | 100 | 91.061 | CDD02842 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. N6H1-15] glutaconyl-CoA decarboxylase subunit beta [Blautia sp. N6H1-15] |
1.15e-108 | 100 | 90.503 | WP_111919941 |
UNVERIFIED_CONTAM: oxaloacetate decarboxylase beta subunit [Murimonas intestini] |
1.25e-108 | 100 | 90.503 | PWJ78764 |
sodium ion-translocating decarboxylase subunit beta [Clostridium transplantifaecale] |
1.29e-108 | 100 | 89.385 | WP_125140134 |
sodium ion-translocating decarboxylase subunit beta [Clostridium sp. PI-S10-A1B] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. PI-S10-A1B] |
1.33e-108 | 100 | 89.385 | WP_117415237 |
hypothetical protein RHS_0325 [Robinsoniella sp. RHS] |
1.67e-108 | 100 | 90.503 | KLU73850 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Robinsoniella] Glutaconyl-CoA decarboxylase subunit beta [Robinsoniella peoriensis] |
1.81e-108 | 100 | 90.503 | WP_027294677 |
sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF27-2AA] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF27-2AA] |
1.85e-108 | 100 | 89.385 | WP_118532159 |
sodium ion-translocating decarboxylase subunit beta [Lachnoclostridium sp. An14] glutaconyl-CoA decarboxylase subunit beta [Lachnoclostridium sp. An14] |
1.95e-108 | 100 | 89.385 | WP_087221496 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Clostridium] Glutaconyl-CoA decarboxylase subunit beta [uncultured Clostridium sp.] glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF46-9NS] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF46-12NS] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF36-18BH] |
2.01e-108 | 100 | 91.061 | WP_117464958 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
2.04e-108 | 100 | 88.827 | HBN57439 |
sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF34-10BH] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF34-10BH] |
2.06e-108 | 100 | 91.061 | WP_118537227 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Clostridium] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF32-12BH] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AM42-4] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. OF09-36] glutaconyl-CoA decarboxylase subunit beta [Lachnoclostridium sp.] |
2.48e-108 | 100 | 89.385 | WP_118543006 |
sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AM33-3] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AM33-3] |
2.53e-108 | 100 | 89.385 | WP_118732348 |
sodium ion-translocating decarboxylase subunit beta [Blautia hydrogenotrophica] sodium ion-translocating decarboxylase, beta subunit [Blautia hydrogenotrophica DSM 10507] putative uncharacterized protein [Blautia hydrogenotrophica CAG:147] Glutaconyl-CoA decarboxylase subunit beta [Blautia hydrogenotrophica] Glutaconyl-CoA decarboxylase subunit beta [uncultured Blautia sp.] |
2.59e-108 | 100 | 89.944 | WP_005945829 |
sodium ion-translocating decarboxylase subunit beta [Dorea phocaeensis] |
2.79e-108 | 100 | 89.944 | WP_101694486 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
2.85e-108 | 100 | 89.944 | HBA69351 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium AM48-27BH] |
3.02e-108 | 100 | 89.385 | WP_118562819 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM12-48] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF33-11BH] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. TM09-4] Glutaconyl-CoA decarboxylase subunit beta [Blautia obeum] |
3.19e-108 | 100 | 90.503 | WP_055057872 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] putative uncharacterized protein [Clostridium sp. CAG:43] sodium ion-translocating decarboxylase subunit beta [Lachnoclostridium sp. SNUG30386] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF12-41] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AM18-55] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF50-3] |
3.67e-108 | 100 | 88.827 | WP_022360208 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] glutaconyl-CoA decarboxylase subunit beta [Ruminococcus sp. CAG:9-related_41_34] putative uncharacterized protein [Ruminococcus sp. CAG:9] sodium ion-translocating decarboxylase, beta subunit [Ruminococcus sp. 5_1_39BFAA] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. TM10-9AT] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF13-37] |
4.33e-108 | 100 | 90.503 | WP_008704466 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Ruminococcus] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM22-13] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AM07-21] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF37-6AT] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF31-16BH] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF24-32LB] |
4.42e-108 | 100 | 90.503 | WP_118247991 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium] |
4.76e-108 | 100 | 89.944 | WP_158434052 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Clostridium sp. AF19-22AC] |
4.82e-108 | 100 | 89.385 | WP_118618684 |
glutaconyl-CoA decarboxylase subunit beta [Lachnospiraceae bacterium] |
5.46e-108 | 100 | 88.827 | HAJ73490 |
sodium ion-translocating decarboxylase subunit beta [Eisenbergiella sp. OF01-20] sodium ion-translocating decarboxylase subunit beta [Eisenbergiella sp. OF01-20] |
6.91e-108 | 100 | 89.385 | WP_118678191 |
sodium ion-translocating decarboxylase subunit beta [Eisenbergiella tayi] sodium ion-translocating decarboxylase subunit beta [Eisenbergiella tayi] |
7.22e-108 | 100 | 89.385 | WP_154465474 |
sodium ion-translocating decarboxylase subunit beta [Faecalicatena orotica] oxaloacetate decarboxylase beta subunit [Faecalicatena orotica] oxaloacetate decarboxylase, beta subunit [Faecalicatena orotica] |
8.69e-108 | 100 | 88.827 | WP_109730262 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Blautia luti DSM 14534] sodium ion-translocating decarboxylase subunit beta [Ruminococcus sp. AF41-9] |
9.81e-108 | 100 | 89.944 | WP_119233584 |
sodium ion-translocating decarboxylase subunit beta [[Ruminococcus] torques] sodium ion-translocating decarboxylase, beta subunit [[Ruminococcus] torques ATCC 27756] putative uncharacterized protein [[Ruminococcus] torques CAG:61] Glutaconyl-CoA decarboxylase subunit beta [uncultured Ruminococcus sp.] glutaconyl-CoA decarboxylase [Lachnospiraceae bacterium 8_1_57FAA] hypothetical protein HMPREF1025_02150 [Lachnospiraceae bacterium 3_1_46FAA] |
1.09e-107 | 100 | 89.385 | WP_004845027 |
sodium ion-translocating decarboxylase subunit beta [bacterium D16-50] sodium ion-translocating decarboxylase subunit beta [bacterium D16-50] |
1.21e-107 | 100 | 90.503 | WP_120477163 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF19-10LB] sodium ion-translocating decarboxylase subunit beta [Blautia sp. AF19-10LB] |
1.3e-107 | 100 | 89.944 | WP_118251464 |
sodium ion-translocating decarboxylase subunit beta [Bacteroides xylanolyticus] sodium ion-translocating decarboxylase subunit beta [Hungatella sp.] oxaloacetate decarboxylase beta subunit [Bacteroides xylanolyticus] |
1.3e-107 | 100 | 88.268 | WP_104436867 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [Clostridiales] sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium OF09-33XD] |
1.34e-107 | 100 | 89.944 | WP_118642732 |
sodium ion-translocating decarboxylase subunit beta [Lachnospiraceae bacterium 28-4] sodium ion-translocating decarboxylase, beta subunit [Lachnospiraceae bacterium 28-4] |
1.39e-107 | 100 | 89.944 | WP_016290408 |
sodium ion-translocating decarboxylase subunit beta [Blautia sp. OM07-19] sodium ion-translocating decarboxylase subunit beta [Blautia sp. OM07-19] sodium ion-translocating decarboxylase beta subunit [Blautia sp. CAG:237] |
1.44e-107 | 100 | 89.944 | WP_022213775 |
MULTISPECIES: sodium ion-translocating decarboxylase subunit beta [unclassified Bacteria (miscellaneous)] sodium ion-translocating decarboxylase subunit beta [bacterium D16-54] sodium ion-translocating decarboxylase subunit beta [bacterium D16-56] |
1.47e-107 | 100 | 89.944 | WP_120420451 |
sodium ion-translocating decarboxylase subunit beta [Firmicutes bacterium] putative uncharacterized protein [Firmicutes bacterium CAG:424] |
1.47e-107 | 100 | 88.827 | WP_022267939 |
sodium ion-translocating decarboxylase subunit beta [bacterium 1XD8-92] sodium ion-translocating decarboxylase subunit beta [bacterium 1XD8-92] |
1.56e-107 | 100 | 89.944 | WP_129181042 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcaceae bacterium] |
1.64e-107 | 100 | 89.944 | WP_019161472 |
sodium ion-translocating decarboxylase subunit beta [Ruminococcus gauvreauii] |
1.67e-107 | 100 | 89.944 | WP_044983184 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_384 In blautia CP039126.1
Seq (len = 38 ):
LSFFGGNAVNCILALTNSGGRCASHSIPLMKMPPRIAV
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|128214|1|3385863-3386001
Transkriptom
99.0% of gene length expressed over median expression of contig.
ŝ
1.7273849391506013
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_385 In blautia CP039126.1
Seq (len = 18 ):
GKYRDFSFMIGLRQEERK
see in UCSC-Genome-Browser
orientation --->
ID:
blautia|CP039126.1|108535|1|2828660-2828714
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.3658587410605971
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_386 In bifi AE014295.3
Seq (len = 107 ):
VRFRNAEASFAGTGSIRSLLPLPWTWSTMPSAFSSRSVFRLILVISMRRRPQNAPSMTASRAFSSGDASPCSMFSSGQMQPDGRVMGTVGTSSAGLRRASPRFMLHW
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|92235|-1|383593-383962
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.4899020248116575
unique PSMS
2
unique PSMS
2
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_387 In bifi AE014295.3
Seq (len = 38 ):
YAGRDEASDGTPLAAVALRLRAYRRRQLFEVWADVRRY
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|91586|-1|426389-426503
Transkriptom
6.0% of gene length expressed over median expression of contig.
ŝ
1.8260371654766507
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_388 In bifi AE014295.3
Seq (len = 35 ):
IPAAAEVPASAGRHRRHRMEAQRRYDCGHRNPADH
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|87565|-1|603564-603672
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.596307662438871
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_389 In bifi AE014295.3
Seq (len = 61 ):
GEVCRRRSSCPNLHPNNPHPSPPRWPRCQRHHQLGPPTLRATSRHWCSPQRPNPYRGAHTR
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|7660|1|349679-349862
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.4059759642685794
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein LAJLEIBI_00210 [[Clostridium] hylemonae DSM 15053] |
1.99e-07 | 23 | 77.273 | QEK16230 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_390 In bifi AE014295.3
Seq (len = 49 ):
MYGWHSEFGFAGIGRFGETVDVGLLGCGLWLISASVRLRHDGIGHGRSR
see in UCSC-Genome-Browser
orientation <---
ID:
bifi|AE014295.3|52770|-1|2151846-2152071
Transkriptom
25.0% of gene length expressed over median expression of contig.
ŝ
1.5058454059815571
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_391 In bifi AE014295.3
Seq (len = 95 ):
LTDTHGRVGDDATATGVAFVGKGHQIIQRHIAVCDAEQLHQPVFRHDGVKAAAVTARTDGTQRVDLDMADFTGQAGHAMHDFAVDDDACANPVVG
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|46923|1|2113311-2113749
Transkriptom
95.0% of gene length expressed over median expression of contig.
ŝ
2.3045183235098023
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_392 In bifi AE014295.3
Seq (len = 21 ):
YAWAAGRRPAPTWPAAVATRR
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|35026|1|1604012-1604075
Transkriptom
12.0% of gene length expressed over median expression of contig.
ŝ
1.310099458929406
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_393 In bifi AE014295.3
Seq (len = 46 ):
LSGMSSMLACTWVRGAGMASMPRMPRISSPDCACLGAYTVRQIRRE
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|23999|1|1107277-1107442
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.9951056782689505
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_394 In bifi AE014295.3
Seq (len = 57 ):
MLGSLNSWNEPMMLKITVIARLPRNSGSLMLFTICHSDAPSMLAASYRECGMVDSEL
see in UCSC-Genome-Browser
orientation --->
ID:
bifi|AE014295.3|22279|1|1025315-1025525
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.794434776469894
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_395 In bact CP040530.1
Seq (len = 12 ):
RLPALLILPVRH
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|75189|1|1835819-1835855
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.3665315444204134
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 13 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
ATP-dependent helicase [Bifidobacterium longum subsp. longum]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
ATP-dependent helicase [Bifidobacterium longum subsp. longum] |
1.27e-06 | 93 | 84.211 | OJS83318 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_396 In bact CP040530.1
Seq (len = 41 ):
LNFLLPVARTEWPETSIYGFPIRIHRMFLVPVTFRLPAHPH
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|436141|-1|2085054-2085192
Transkriptom
86.0% of gene length expressed over median expression of contig.
ŝ
1.8583412302134472
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 32 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Transposase, family [Pseudomonas syringae pv. aptata]
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
Uncharacterised protein [Bifidobacterium longum subsp. infantis] |
0.0 | 62 | 94.903 | SPU41745 |
Transposase, family [Pseudomonas syringae pv. aptata] |
3.16e-18 | 36 | 34.979 | KPY99772 |
hypothetical protein [Tanacetum cinerariifolium] |
1.65e-14 | 23 | 38.961 | GEY66987 |
hypothetical protein [Tanacetum cinerariifolium] |
5.33e-14 | 47 | 31.132 | GEU28367 |
hypothetical protein COLAER_00909 [Collinsella aerofaciens ATCC 25986] |
6.84e-14 | 34 | 34.934 | EBA39762 |
hypothetical protein BM221_006376 [Beauveria bassiana] |
2.32e-13 | 37 | 37.200 | PMB68199 |
uncharacterized protein BN642_00507 [Collinsella sp. CAG:398] |
2.12e-12 | 23 | 39.474 | CDD41178 |
transposase, IS481 family [Bordetella pertussis STO1-CHOC-0017] |
4.35e-12 | 37 | 37.200 | ETH83299 |
hypothetical protein AZA_76900 [Nitrospirillum amazonense Y2] |
4.73e-12 | 37 | 36.694 | EGY00670 |
HAD-superfamily hydrolase [Bifidobacterium callitrichos DSM 23973] |
1.67e-11 | 76 | 31.538 | KFI56632 |
hypothetical protein E6I10_02210 [Chloroflexi bacterium] |
2.06e-11 | 22 | 36.486 | TMF99482 |
hypothetical protein a10_03764 [Streptomyces acidiscabies] |
2.57e-11 | 77 | 30.651 | GAQ53959 |
Uncharacterised protein [Collinsella intestinalis] |
2.85e-11 | 33 | 35.160 | VWM23603 |
Uncharacterised protein [Klebsiella aerogenes] |
7.56e-11 | 21 | 33.333 | VFT75682 |
hypothetical protein L810_0924 [Burkholderia sp. AU4i] |
3.16e-10 | 36 | 36.255 | ERJ36121 |
Uncharacterised protein [Shigella sonnei] |
1.63e-09 | 21 | 27.465 | CSG17181 |
unknown [Zea mays] |
2.37e-09 | 28 | 32.979 | ACR35398 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
3.72e-09 | 25 | 37.278 | SIA90405 |
Putative uncharacterized protein [Thermotoga neapolitana DSM 4359] |
1.54e-08 | 33 | 25.561 | ACM23492 |
putative uncharacterized protein [Clostridium sp. CAG:299] |
1.6e-08 | 30 | 26.866 | CDD40416 |
hypothetical protein [Pseudomonas sp. 22 E 5] |
3.07e-08 | 27 | 34.270 | CRM72492 |
Uncharacterised protein [Mycobacteroides abscessus subsp. abscessus] |
1.99e-07 | 24 | 31.977 | SKY08643 |
hypothetical protein [Tanacetum cinerariifolium] |
2.11e-07 | 25 | 32.353 | GEX44921 |
hypothetical protein [Tanacetum cinerariifolium] |
2.28e-07 | 22 | 37.654 | GFC74499 |
putative uncharacterized protein [Clostridium sp. CAG:1013] |
3.24e-07 | 31 | 31.100 | CCX37119 |
ParB N-terminal domain-containing protein [Rhodovulum visakhapatnamense] |
8.74e-07 | 26 | 35.393 | WP_134079572 |
hypothetical protein CTA1_2384 [Colletotrichum tanaceti] |
1.28e-06 | 33 | 37.168 | TKW51306 |
hypothetical protein CTA1_4387 [Colletotrichum tanaceti] |
1.49e-06 | 30 | 38.191 | TKW51410 |
hypothetical protein BSTEL_2162 [Bifidobacterium stellenboschense] |
1.97e-06 | 22 | 38.217 | KFI92579 |
hypothetical protein E6I20_00455 [Chloroflexi bacterium] |
3.18e-06 | 23 | 34.868 | TMF68286 |
hypothetical protein BM221_007458 [Beauveria bassiana] |
3.69e-06 | 36 | 31.148 | PMB66469 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_397 In bact CP040530.1
Seq (len = 87 ):
ISVWAENQAARIPGNGSSPIQSSAPTKAVFHPPAAPTVKWCLTLLLLISKIYKKSFVSWFIVLRIIHAIFSCYESSVFPPNRVGFFS
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|413496|-1|2673003-2673387
Transkriptom
38.0% of gene length expressed over median expression of contig.
ŝ
1.9822712330395682
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 25 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_398 In bact CP040530.1
Seq (len = 23 ):
LFCIYTSLSIVYIGIMPKCTNSR
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|401124|-1|2971621-2971732
Transkriptom
12.0% of gene length expressed over median expression of contig.
ŝ
1.5147519190496412
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_399 In bact CP040530.1
Seq (len = 57 ):
MNGATVARCPAASTNPETPTTRLFYRMVLLFIMQPMAKDWEDMIFLSLVTTQIRTLI
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|389234|-1|3280743-3280914
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.399753349435506
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 24 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_400 In bact CP040530.1
Seq (len = 15 ):
KLSESHVYQPTSIPK
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|354227|-1|4152104-4152149
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.1634649081016306
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_401 In bact CP040530.1
Seq (len = 36 ):
SYKEEVAVFSPDKTLSANSSVSHPNCILCFISIMLR
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|303648|-1|5334319-5334427
Transkriptom
22.0% of gene length expressed over median expression of contig.
ŝ
1.469800301796918
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein BBRP734_01696 [Bifidobacterium breve] |
1.38e-20 | 98 | 75.000 | VTZ99616 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_402 In bact CP040530.1
Seq (len = 25 ):
IYVPFAAVGFSLFRVEMNSFALSRI
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|26995|1|694618-694702
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7351821769904634
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 36 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_403 In bact CP040530.1
Seq (len = 75 ):
MQMNVAGEPRKIDYSHQSTYYCSQAGGKGSTHHSPAKFKDENIVEYNIEYSCDGIAHHGIIGRSVQPDEKHACAQ
see in UCSC-Genome-Browser
orientation <---
ID:
bact|CP040530.1|266196|-1|6209557-6209791
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.407823242604133
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_404 In bact CP040530.1
Seq (len = 16 ):
VSERRTAIMSCSATPT
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|258138|1|6129133-6129229
Transkriptom
71.0% of gene length expressed over median expression of contig.
ŝ
2.0247214088082206
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 11 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein BHV72_18290 [Bacteroides sp. 43_46] |
4.08e-06 | 39 | 64.706 | OKZ13972 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_405 In bact CP040530.1
Seq (len = 168 ):
IQNRKKHPNCYTVFLLSDTVLPDKDHVCRSKDRFNKQKRSVYRTKKEIGLPDQFGEILRQRIAQNRQCDRFHQHFARSRVHRILLVRAESVGGLHDNRDFLVFSADDFRSIQSVHHRHFDVHQDRFGLVAVFLEQCHDFFAILGPLYITFLSDDCFDQFEVAVVVLSH
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|258103|1|6127407-6128001
Transkriptom
89.0% of gene length expressed over median expression of contig.
ŝ
2.159893905543242
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 18 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_406 In bact CP040530.1
Seq (len = 104 ):
MKQAVDIRSTAGFHTPIIDTPKHTHIRGNRIGLQTTFVKVLFVTAKTLTGDLTERHTMDTTKLAKRKKGVLIDVRCRIAALLSQTADIDIGTSTKSIFIHYLHH
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|242403|1|5702660-5703659
Transkriptom
70.0% of gene length expressed over median expression of contig.
ŝ
1.3591874196800209
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_407 In bact CP040530.1
Seq (len = 56 ):
MSTSNKVYILTLGKPALKKDIATIFDYAEIQEFPNTREQEKFSQKWLNSFLNRETY
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|229800|1|5379669-5379879
Transkriptom
60.0% of gene length expressed over median expression of contig.
ŝ
1.5911949149182312
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_408 In bact CP040530.1
Seq (len = 10 ):
IFAFGSSQTQ
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|228246|1|5338193-5338274
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.730954290342377
unique PSMS
1
unique PSMS
1
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_409 In bact CP040530.1
Seq (len = 16 ):
IKMAIISMWMRISKML
see in UCSC-Genome-Browser
orientation --->
ID:
bact|CP040530.1|120018|1|2840896-2841007
Transkriptom
62.0% of gene length expressed over median expression of contig.
ŝ
1.626658821958146
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 8 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_410 In anaero CP036345.1
Seq (len = 139 ):
MSICFASTSTSNAIFIEQFSFQTTYKPVFSAIYFRAFNAYSKGLAAAGSCSASTTTYPSYPLFSMMSKIGSKSTSPSPGTVNVPFLTPFKKLQPSFLDWFTTSVRRSFKWICLVLSMYFLRTFTGSIPAKEQCPLSNSR
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|96384|1|2451407-2451857
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
2.0324520237811377
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_411 In anaero CP036345.1
Seq (len = 72 ):
IGALLQFLDHLLCSPLSKRKPDILALILFHVVTHILRNKMTSQSINISDVDISAGHSGYFTDHASSFIQHIQ
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|80051|1|1994112-1994340
Transkriptom
31.0% of gene length expressed over median expression of contig.
ŝ
1.6439741428068773
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_412 In anaero CP036345.1
Seq (len = 18 ):
IFKISAWNGTLQGSSIII
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|52900|1|1277744-1277864
Transkriptom
86.0% of gene length expressed over median expression of contig.
ŝ
1.8447652084805892
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
hypothetical protein HMPREF2534_02547, partial [Bacteroides thetaiotaomicron] |
7.66e-68 | 100 | 100.000 | KXT37307 |
Uncharacterised protein [Bacteroides thetaiotaomicron] |
5.24e-63 | 100 | 94.231 | CUN23780 |
hypothetical protein HMPREF2534_04245, partial [Bacteroides thetaiotaomicron] |
4.56e-50 | 99 | 81.553 | KXT31781 |
hypothetical protein BXY_15800 [Bacteroides xylanisolvens XB1A] |
1.94e-09 | 53 | 48.214 | CBK66701 |
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_413 In anaero CP036345.1
Seq (len = 59 ):
DRKRTGDQAQGSGGNQRSFRQCDDRSLRGDGRCLHCPGRKDLQGTDPAAAERPTGCGKE
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|31649|1|757487-757664
Transkriptom
100.0% of gene length expressed over median expression of contig.
ŝ
1.7026042889911126
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 1 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_414 In anaero CP036345.1
Seq (len = 164 ):
MQLGEAEPLGVLHHHDRGIGHVDTDLNNCGRHQDLDAALRKFIHNLLLFLWFHFTMKHPDLYTGRKLFSQHIGILNHIFTLHGLAFLHHWADNIDLPPLCHLLLHESIRIRTVTLIDNTIFNWKTVLRQLIDDGHIQISVHNDRQGPRYRSGTHNEDMGFLPLL
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|227286|-1|1292492-1293080
Transkriptom
90.0% of gene length expressed over median expression of contig.
ŝ
1.9578184054842334
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
True candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ > 2.5} →{no overlap with annotation}
Candidate nov_psm6_415 In anaero CP036345.1
Seq (len = 364 ):
MLALAAAGCQKKSEQNQKPFVSEKDLKAFIGETTKKDEVSDFPKLDYASDDRVMFHNSQGFYVFDLKEKKVTAALDLAKMKLFSEDGETEAKIIVSSDGNMVRLLRTKGEDTVKDYFYDVKEQTLSDKKQAFDDVYEGDIQNTDKKKFAGRPKEEVIRELMENGQNDSNALIQNDSTVDFLGYPSGVYMKEDQMFKNLSLVQYDVKAKKKTVTSLFDGFVKTDRETDASKLVFKGSRFMKFSENGVLYFDVDAMQKTDGTKGTFGELVIGNVFQSKSGKLTVTFEDISKGDLSLKPVLSLNNIDEKGEPQMIELTKGKNTYTFSGLKKELFYYIDYYATKDAPDEKSMEKTDQQNKKLRVSISS
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|173738|-1|2691526-2692672
Transkriptom
99.0% of gene length expressed over median expression of contig.
ŝ
3.3272558016934006
unique PSMS
2
unique PSMS
2
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_416 In anaero CP036345.1
Seq (len = 677 ):
MGFSNFTIEGGNIEASGGDHCPGIGCACVSEYYSSGYGYTKNIRISGGNVTATGTAYGSGIGSGYGSKVEGVYITGGTVMARGGYRAPGIGASDCGTYTQSTETVDLEISGGDTVVTAVGDQSTDMPGIGAALGLDYVKNANVIPKERYQGYIQDGESEDNYLFSNDTPFSEKSEIKVKKFFTMVYFGPYRDSNGIDQDTKEQLGANHVISKTGGDEFTQGQIKALTKVTGKQADGSTIPDSKILFDDPSQLEAVNQAKKEGKTGEYPLTFSTENGTKVTVTICLRSEGTDSAELDVQNPSSVIGANSFQSESGGPAFTEQEVKELGKLKGKDKDGNNIPFDDIKLSKEQLDQINDAKTANKNGSFTLTFETPDGKKAEITVTLTGGRDVTNVTESGDKIMANHVISSTGGKGFTEAQIKVLTGLAGSKDDGTPYTIDELSFSDAKQLEKINKAKTSGKTGDYPLSFQTPQGTEITVTVYLRKEGSDNAEYRPEAPSASIGANDTVQPTGGKAFTEDEIINLCGAKGKDKDGVDAQITVNKKQLDVINGAKAAGKTGSFELTFSMPDGTEVTVKVTLTGEHKVSFDSKGGSYTPDVQKVEGGKQAVKPKEPQKKGYTFEGWFYTDENGIETVWDFSTPVHQDMTLKARWKKAAEQLNVQEMGETSGDKKTKNKKDES
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|165839|-1|2902182-2904960
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.9061115824103574
unique PSMS
3
unique PSMS
3
Genomic Context
No overlap with any annotation.
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_417 In anaero CP036345.1
Seq (len = 24 ):
LSKEITGGSDEINGKVVMPKKKQT
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|159154|-1|3073476-3073620
Transkriptom
81.0% of gene length expressed over median expression of contig.
ŝ
1.8519117293377814
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_418 In anaero CP036345.1
Seq (len = 52 ):
QRCVQQGVWDDRLNGECGRYLCSGKGETGIRHRQAVCDGQGHALSGIHAAFP
see in UCSC-Genome-Browser
orientation <---
ID:
anaero|CP036345.1|149013|-1|3316138-3316294
Transkriptom
0.0% of gene length expressed over median expression of contig.
ŝ
1.388630784537266
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on SAME strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Novel
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|
Candidate
False candidate
{num(PSMs) > 5} →{ŝ < 3.5} →{num(unique peptides) < 3}{ŝ < 2.5}
Candidate nov_psm6_419 In anaero CP036345.1
Seq (len = 28 ):
MHFYLSKMHILPPGLKHRLKLHLYCPLS
see in UCSC-Genome-Browser
orientation --->
ID:
anaero|CP036345.1|133436|1|3494748-3494925
Transkriptom
88.0% of gene length expressed over median expression of contig.
ŝ
1.4984843063351878
unique PSMS
1
unique PSMS
1
Genomic Context
Candidate has annotation on OTHER strand. Which has 0 unique PSMs
Genome Browser
The Gene
![]()
The Genomic Context
![]()
Blast Results
Blast Results
Hypothetical
| Description | e-value | Query Coverage | Sequence Similarity | Ref Seq |
|---|---|---|---|---|
unknown [Firmicutes bacterium CAG:466] |
4.32e-15 | 100 | 32.927 | CDC27889 |
unknown [Ruminococcus sp. CAG:382] |
2.32e-13 | 96 | 31.013 | CDD03021 |
hypothetical protein ALP75_204885 [Pseudomonas syringae pv. actinidiae] |
4.69e-13 | 95 | 31.250 | RMS11058 |
Uncharacterised protein [Neisseria meningitidis] |
8.68e-13 | 100 | 32.927 | CWS89183 |
Uncharacterised protein [Neisseria meningitidis] |
3.44e-12 | 100 | 32.317 | CWT61235 |
Uncharacterised protein [Neisseria meningitidis] Uncharacterised protein [Neisseria meningitidis] |
1.21e-11 | 100 | 31.707 | CWM98311 |
conserved hypothetical protein [Thiomonas sp. CB3] |
3.07e-10 | 88 | 31.333 | CQR44115 |
unknown [Roseburia sp. CAG:303] |
2.03e-09 | 62 | 39.604 | CDE53533 |
hypothetical protein NM1476_2204 [Neisseria meningitidis NM1476] |
7.48e-08 | 49 | 35.000 | EQD18079 |
Uncharacterized protein Greene101449_1149 [Candidatus Peregrinibacteria bacterium Greene1014_49] |
7.89e-07 | 41 | 38.806 | TSC97621 |