Candidate list






Candidate 1 in ecoli U00096.3

Seq (len = 211):

ILAYLLKHDSNYGPFPWSVDFTEDSLIVDGKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAEKSQAHLDAGAKKVLISAPAGEMKTIVYNVNDDTLDGNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYTGTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPELSGKLKGHAQRVPVKTGSVTELVSILGKK

Score 3.5

score spec = 1; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

ecoli|U00096.3|285462|-1|1489963-1490596

Note:

Good only two distinct peps. The most of them have a better mapping to blautia.




Candidate 2 in blautia CP039126

Seq (len = 783):

KIMKRKVKRLLAMFLTFIMVFSMGTVFVSAAEEGTGKSTETAGKPELSKKTADSVVLKTKDGYVYGIQENGSKWKWAEDKQYDKTAKTVSFTGLKAETEYVFAGKTKDAETVQDTDTLKVKTEAAAVQTETPKTEEPPKAENTDNNGEINKPQGGDLNTEQTKPEETNKTDTETNTPPSVGETTGSAEGTQDIDKDTTKDTLTDNAGEPKADEPKVDEPKVDEPKVDKPKVDEPKADEPKVDEPKKDESKADDSNKDESKGVESKGEEQKTNSSENKVNDANGLKGSNNANDTLQKATKPNPPVVDKVTDTSVVLKPSSDADKYTYSYKLVLKDNKAKATELINDKGEFTGLTPDTDYLAYIMVKGDSNASPSYADSEWSDAAEVHTLKAAAEKPKAAPKLAEKTDTTIKLDTSTANLEYGVYLDGGNISWNNTGEFKGLTAGKEYEFVTRVKFDKDKQMESPVSDSLKVTTKKAAAAAPEAPVCIGRTENSITLRAVNGQEFAMLENGTPGKWQDSEVFSGLKANTRYSFVTRVKYNPDEAMESKVSSSASGKTIIAFEGSSVTGIEVNGVYDKNTVVNMAANGNGTDNQNPEGQDTRWVPESWKWGSSAKGTWNKSPYTAKLTLNKAGKMELQVVFRLEEYTEKGWTAMTAEKKTITVPFSVKEQYTITASAGSNGKISPSGSVKVMEGNDATFTITPNKGYQISQVTVDGKAVTVKNSKYTFEDVSANHKISVTFKKLTKTVPKTGDTMNMAGYLMLAVLSAGAVFTVLLSAKRKKTNHR

Score 3.5

score spec = 1; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|3533|1|77695-80044

Note:

Good multiple distinct peptides




Candidate 3 in blautia CP039126

Seq (len = 399):

ARDYEMRNTHMSKFLKFIVNLVVICAILVAAALLVPPFAGVNTVMNDNSSKETNLPVGSVAYGREIDAASLKKGDKIIYTNNNKAYVYKVTDMDSSAGSYKVKSVYDKNAKEETVQLINNAVKVVVVVPYIAYAAIALQSKEGLIVVGLGVIFLIILFILAELWRKDEADDDEEEDEEEEDASDEDDSEEDEDEDEEEEKLSRKERKRLKKEEKRRRKLAKKGLSDEEEAEDDEAEAPVLEPAPAPAKQPDEYDSAMKDAMASIAESIAKVQNGEIEAPEEVQETAVPQVTAEIILGLEENADSEEPAAEIISDDTAIQETADEEAVQPQEEMAAEEEVQQEEEIEPEPEEVPVVDKEAVLPAPSVTELLSKAEAAGESPEVIEDKDNEVTLLDYSKLL

Score 3.5

score spec = 1; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|267399|-1|5098784-5099981

Note:

Good. Three distinct peptides.




Candidate 4 in blautia CP039126

Seq (len = 72):

MERRPAMGIKVKVNFDKRKLESAIKDQARESLRNRSYDAKCPFCHTTFSAHPGPNVCPHCRKTVDLNLNIKL

Score 3.43

score spec = 1; score region = 1; score transkriptom = 0.93; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|146236|1|3946668-3946884

Note:

Good. Two distinct peptides. Small.




Candidate 5 in bact CP040530

Seq (len = 61):

ILNCMSRRSQLEHEVSVAQERIKKAAKDTPKDIIKLWEQDLVDLELELNNLVDDEEDNNED

Score 3.38

score spec = 1; score region = 1; score transkriptom = 0.88; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|338414|-1|4553297-4553480

Note:

Good. Small. Two pep.




Candidate 6 in blautia CP039126

Seq (len = 57):

RMTGQAGRGGNMEDNMTDKQFKTILEMFGMILDGCKDLEEAKKKVEKLLEEQKNKSE

Score 3.25

score spec = 0.75; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|406328|-1|1268009-1268180

Note:

Not Bad. Two ditinct peptides. Gene duplication with 7, 8?




Candidate 7 in blautia CP039126

Seq (len = 57):

RMTGQAGRGGNMEDNMTDKQFKTILEMFGMILDGCKDLEEAKKKVEKLLEEQKNKSE

Score 3.25

score spec = 0.75; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|382198|-1|1986304-1986475

Note:

Not Bad. Two ditinct peptides. Gene duplication with 6, 8?




Candidate 8 in blautia CP039126

Seq (len = 57):

RMTGQAGRGGNMEDNMTDKQFKTILEMFGMILDGCKDLEEAKKKVEKLLEEQKNKSE

Score 3.25

score spec = 0.75; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|153241|1|4151451-4151622

Note:

Not Bad. Two ditinct peptides. Gene duplication with 6, 7?




Candidate 9 in bact CP040530

Seq (len = 148):

NRMEDFLKFLLIAGVILVGIFKEVSKNNKSKKAQNKRPVPPAPSPVEVDPDAIPIPEFWGRGSRALDELLQPIPMEQPAPKPTPKKKKKEEVSVAASIANSSAQDKRNTKQGSHYDHPEPAGEEDFSIHSVEEARRAIIWGEILQRKY

Score 3.25

score spec = 1; score region = 0.75; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|464461|-1|1386611-1387055

Note:

Good. Annotation on other strand but just hypothetical (1)




Candidate 10 in blautia CP039126

Seq (len = 84):

IITLVDGIGLFVMQFFSLSHAKGDGVMATKSIIKDVNIRDNKLCRTFASAIENASGRRGKDVQLSRSFKEISGEKIRELFGDKA

Score 3.23

score spec = 0.75; score region = 1; score transkriptom = 0.98; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|47691|1|1242045-1242297

Note:

Okay. Only one unique peptide. But clear transkriptom elevation and no good annotation around. Just with hypothetical protein (1). Gene duplication with 10?




Candidate 11 in blautia CP039126

Seq (len = 84):

IITLVDGIGLFVMQFFSLSHAKGDGVMATKSIIKDVNIRDNKLCRTFASAIENASGRRGKDVQLSRSFKEISGEKIRELFGDKA

Score 3.2199999999999998

score spec = 0.75; score region = 1; score transkriptom = 0.97; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|302523|-1|4177481-4177733

Note:

Okay. Only one unique peptide. But clear transkriptom elevation and no good annotation around. Just with hypothetical protein (1). Gene duplication with 11?




Candidate 12 in ecoli U00096.3

Seq (len = 375):

MNIYRAVTSFFNNSSKKGLTMKKLTVAISAVAASVLMAMSAQAAEIYNKDSNKLDLYGKVNAKHYFSSNDADDGDTTYARLGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAGLKFGDYGSIDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTQRATGVATYRNNDFFGLVDGLNFAAQYQGKNDRSDFDNYTEGNGDGFGFSATYEYEGFGIGATYAKSDRTDTQVNAGKVLPEVFASGKNAEVWAAGLKYDANNIYLATTYSETQNMTVFADHFVANKAQNFEAVAQYQFDFGLRPSVAYLQSKGKDLGVWGDQDLVKYVDVGATYYFNKNMSTFVDYKINLLDKNDFTKEGANKSLI

Score 3.17

score spec = 1; score region = 1; score transkriptom = 0.67; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

ecoli|U00096.3|318421|-1|575760-576885

Note:

Not so interestring already annotated and only one destinct peptide, for one big protein.




Candidate 13 in blautia CP039126

Seq (len = 126):

IIAVHDIYLVNHPAADITVVMANNNAHTHFTSSFLIDTIVYNFFHISYNLGTGAGTPSTNERRIPMTENQQKLYDFLKSKGGSAHLMDCAMQLDISDEELQLAVNTLVQSGIISKDAYVQPTLRII

Score 3.05

score spec = 1; score region = 1; score transkriptom = 0.55; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|383626|-1|1942316-1942694

Note:

Almost small. Two distinct peptides. clear start of transcriptom rise.




Candidate 14 in clostri CP040627

Seq (len = 17):

LFKKISINTHSQHIEYF

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

clostri|CP040627|37066|1|552987-553038

Note:

CRAP! Really small one peptide. Opposite strand of annotation, but hypo (0). Clostri gets zero hits at transkriptom?




Candidate 15 in clostri CP040626

Seq (len = 51):

LLHYCNKILLKVLLIKTIFKKMNNFTYFFSLSVHNINKMEIIIIKSGKQMY

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

clostri|CP040626|96146|1|1287451-1287604

Note:

Small. One pep. clostri transcriptom.




Candidate 16 in clostri CP040626

Seq (len = 62):

KLLFSGRVFSTVNFLVILYTPQFNTILNLSFNNMNFHLKQNRILKLQFNILKIFYNNVFINK

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

clostri|CP040626|230042|1|3390851-3391037

Note:

All MS from one spec. Clostri trans.




Candidate 17 in clostri CP040626

Seq (len = 26):

YLYHNLIFIILLIPMYYFSVCFSSIF

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

clostri|CP040626|186664|1|2649939-2650017

Note:

One pep. Clostri trans.




Candidate 18 in blautia CP039126

Seq (len = 68):

CYNSCKERRIIMNYACVSKQPFITKKDLSVKKPLLAEAKSRREFIRSHDFTVNVDPSTKIAEIKVTKR

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|97988|1|2548109-2548313

Note:

Little Specs. Two distinct pept.




Candidate 19 in blautia CP039126

Seq (len = 407):

RRKIMLTLEKFEEASETVKKVTQDTKLVYSDYFSAQTGNKVYLKPENMQVTGAYKLRGAYYKISTLSEEERAKGLITASAGNHAQGVAYAAKAFGAKAVIVMPTTTPLIKVERTKSYGAEVVLYGNVYDEACEYAYKMAEEHGYTFIHPFDDPAVATGQGTIAMEIIKELPLVDYILVPIGGGGLATGVSTLVKLLNPNIKVIGVEPAGANCMQMSLKEGEVVTLDGVNTIADGTAVKRPGDHIFPYIQKNVDEIITVEDSELIVAFLDMVENHKMIVENSGLLTVAALKHLKFTGKKVVSILSGGNMDVITMASVVQLGLIARDRIFTVSVLLPDKPGELVRVATVIAQQQGNVVKLDHNQFISANRSAAVELKITIEAFGTDHKNQIIKALEDEGYRPKQITANL

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|93100|1|2420374-2421595

Note:

First hit RNAcode :). Clearly identified. Annotation exist but homology from other species (Roseburia inulinivorans). Also maybe incorrect annotation one instead of two. Merges perfectly with none protein of blautia.




Candidate 20 in blautia CP039126

Seq (len = 393):

KGECLIMYRYHCLNPISSVGLEHFPAKYESTDNMSDADAVLVRSANMHEMELPKNVVAIARAGAGVNNIPLEECAKDGVVVFNTPGANANGVKEMVIAGMLLASRDIVGGIEWLEHQDATEDIGKLAEKKKKQFAGCEISGRKLGIIGLGAIGVKVANAAVHLGMEVYGYDPFISVDAAWNLSRSIHHINDLNVIYKECDYITIHVPLMESTRKMISADEIAQMKEGVVLLNFARDLLVDEEALAEALREGKVKKYVTDFANPLVTSTPNTLVTPHLGASTEESEDNCAVMAVRQLMDYLESGNIKNSVNYPDCDTGACIDVGRVTINHKNIPNMISQFTKVLGDAGVNISNMTNKSKGDFAYTMIDVSTPISGEVAKELKNIHGVYRVRIVK

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|83776|1|2168406-2169585

Note:

RNAcode. Clearly identified. Annotation exist but homology from other species (Lachnospiraceae bacterium, Blautia hansenii). Also maybe incorrect annotation one instead of two. Merges perfectly with none protein of blautia.




Candidate 21 in blautia CP039126

Seq (len = 104):

NVMKIFWKSLCHTRPTSCCIRIITDGRCREKDKFEKAEKIHKSIAFGKHSDTEVNEMDKKQQEALNRKKSNETFNSITQKVKPENQNQQHNARSEAVEPKIRQV

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|83454|1|2161518-2161830

Note:

Really unclear. One pep. One experiment. Big blur of transcriptom.




Candidate 22 in blautia CP039126

Seq (len = 260):

EKVISIRKRIRRMKSYSITDVGQKRTVNQDFVFTSETPVGNLPNLFVVADGMGGHKAGDFASSYAVEVLLSTIREDENSNPVKIIRAAIETANTQLLREASDNEAMSGMGTTMVLVTIVGHYAYVANVGDSRLYLIDENKISQITKDHSLVEEMVRMGEISRDDARNHPDKNIITRALGAGRDVDVDFFDVRLTPGDILLLCSDGLSNMVPDEDIRQVILTSEMLEEAGRRLVSMANDNGGRDNIAVVLVEPETKEVEVC

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|67983|1|1748093-1748873

Note:

RNAcode. Clearly identified. Annotation exist but homology from other species (Lachnospiraceae bacterium). Also maybe incorrect annotation one instead of two. Merges perfectly with none protein of blautia.




Candidate 23 in blautia CP039126

Seq (len = 72):

QKKTYVLEIDLLLVYTLSRIYVPTALSEREVLHMDNKDKKQKDIDTINKLLVNAPEDKVSELLMLIKQYLLQ

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|47059|1|1228632-1228848

Note:

None




Candidate 24 in blautia CP039126

Seq (len = 201):

IKKVNDMTTEEKLQHFYEVSMESAREESEKALEEYRAALSQMLAEHKEDKQKNAGGQLKLETENAKREINKALSAEQLHIKRRLSKKQQELREELFVEVKNKLEAFMSSPEYLVWLEEKIREALTIAGEDEVQIYLTPADTSLLETLAARCGTPLLVSQTPFMGGVRAVIPAKNILIDHTFKTLYENEKEEFNFDGGLLHE

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|434164|-1|443400-444003

Note:

None




Candidate 25 in blautia CP039126

Seq (len = 104):

CIMKMFLISDNIDTYTGMRLAGVEGVVVHEREELRKALEDAIANKENGIILLTEKFGREFPDIIDDMRLNHRLPLIIEIPDRHGTGRAPDFILSYVNEAIGLKL

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|434142|-1|444006-444318

Note:

None




Candidate 26 in blautia CP039126

Seq (len = 885):

FCIDGMGMVYNQEKEANYMNFGKRATDKKRNSLSSRSTMMGKKAHVSFIRIIFISLIAIMVIGGCVGFGAFKGLLDNAPDIRDVNIMPIGSATFVYDSGGNQLQKLTAPNSNRMPVTIDKIPLDLQHAVVAIEDERFYEHNGIDLRGIVRAGVKGITSGFKFSEGASTITQQLLKNNVFKDWTNESMVERFKRKFQEQYLAIQLEKQLKDKDQILESYLNTINLGNGNYGVQAAAHGYFNKDVSELTLSESTVIAGISQNPTRFNPAVNPEENAKRRKDVLDHMLDQGYITKEQYDECLADNVYDRIQAVEAESSEEDDTYTYFIDELTRQVIDDLMTQKGYSEQQAYNALYSGGLRIYTTQDPQIQQICDEEYSNPENFPAGTQVGLDYALTIAHPDGTEENFSKEMMTTYFKAEDPNFSLLFDSQEQAESYIEAFKAAKTEDGSTVIAEQKYFTPQPQSSMCIMDQHTGYVKAIVGGRGEKATSLSLNRATRTVRQPGSTFKIVSTYAPALNECGKTLATVYDDEPYQYKSGKPVNNWLTGSFGGPTTIREAIVNSVNVVAVKCITDITPQLAYDYLLKFGFTTIVDTLTIDGNVYSDIGQPTALGGITRGVSNLELTAAYAAIANNGTYIKPMFYTKILDEDGNVFLDNTPEKTKVIKPSTAYLLTSAMEDVVDHGTGTRLQLNNMHVAGKTGTTEGYNDLWFAGYTPYYTCTVWSGYDDNTKLPSGDYRTYHQDLWRKVMQRLHEDKTDTDFKMPATVEKATVCSETGLLPNYACPTITEYFESDEIPKKRCNVHSNRVYTPPAEETNEPPADTPTDTPTDTPANPPTDNNTPPDTPGDTPTDNPGGDTPTDNPDTPDTPDNPDTPTPPDEGGEGTGGETE

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|405847|-1|1282588-1285243

Note:

None




Candidate 27 in blautia CP039126

Seq (len = 466):

RIMGDVLKKVPVREQDPKVRATNFEEVCYGYNKEEAMEEAARCLTCNNAKCVKGCPVNIDIPGFIKEVKEGNFEEAFKVIGQSSALPAVCGRVCPQETQCEGLCIRGIKGEPVSIGKLERFVADWAKENGIKPEPPKEKNGHKVAVIGAGPAGLTCAGDLAKMGYDVTIFEALHQPGGVLVYGIPEFRLPKDKVVKMEVENVKALGVKIETNVIIGKSTTIDELMEKEGFEAVFIGSGAGLPMFMGIPGEISNGVFSANEYLTRSNLMKAFRDDHDTPIKMGKKVAVVGGGNVAMDAARTALRLGAEVHIVYRRSEAELPARAEEVHHAKEEGIIFDLLCNPTEILADENGWVKGMKCVRMELGEPDASGRRRPVEIPDSEFEIELDTVIMSLGTSPNPLISSTTIGLDTNKRKCIIADEENGKTTKDGVYAGGDAVTGAATVILAMGAGKSAAQGIDEFIKGKNN

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|345436|-1|3085529-3086927

Note:

None




Candidate 28 in blautia CP039126

Seq (len = 287):

YQRCKIPTSMNTKGRCLRTSVRQCPCGEEIDGRKQPKRRKNMSVISMKQLLEAGVHFGHQTRRWNPKMAPYIYTERNGIYIIDLQKSVGMVDDAYKAVADIAADGGTILFVGTKKQAQDAIKVESERCGMFYVNERWLGGMLTNFKTIQSRIGRLKEIEAMEADGTFDVLPKKEVIELKKEQTKLEKNLGGIKEMKKLPDAIFIVDPKKERICVQEAHTLGIPLIGICDTNCDPEELDYVIPGNDDAIRAVKLIVSKMADAVIEANQGAAEDSEIFKEAVEEEATEE

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|326114|-1|3557928-3558789

Note:

None




Candidate 29 in blautia CP039126

Seq (len = 242):

EQGRTGQPGGKNQTGRERPGYRTYYRLRSQYNMKNLNLRGIVVGPVMTNCYFLKNTQSGEILVVDPAAEAERICRTVERIEGKPAGILLTHGHYDHIMAVGELKEKWQVPVYAAKAEEDMLTDPQMNLSASWEGLDYTVKADCLLKDGEIFELAGFQIKMYLTPGHTEGSCCYYIEDEGVLMSGDTIFCENCGRCDLPGGNFAKMQESLDKIINHLPEDVKIYPGHGEETSIHHERSYNPYL

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|324786|-1|3592020-3592746

Note:

None




Candidate 30 in blautia CP039126

Seq (len = 1008):

WKIRDLWEVFIMGDKMTCMPFSQIMDWVLEEKKANKTVFGTHKKYVAGEEKTEIFGRNLETPIGPAAGPHTQLAQNIIASYYTGSRFFELKTVQIMDGAELSACVNKPCILAEDEGYNCEWSTELTVPDAMSEYIKAWFALHVMAKEFGLGAQDGFQFNISVGYDLAGIKSEKINHFIDTMMHAGQDATFTECKKWLLKNIEKFDKYTKEDVEAIPEDICNSATISTLHGCPPHEIESIANYLLTEKHINTFVKCNPTLLGYEFARKTMDEMGYDYMMFGDFHFKDDLQYEDAVPMFTRLMKLSEELGLSFGVKITNTFPVDVTRQELPSEEMYMSGKALFPLSISLAAKLAKEFDGRLRIAYSGGADYYNISRIVGAGIWPVTVATTLLKPGGYNRSAQMAEFLVKEGLKPFTGIDVEAVTKLAEDAKGDVHHVKPIKPLPNRKVKDSVPLMDCFMAPCEAGCPIHQDVSNYMELASAGKYEEALEVILDKNPLPFITGTICAHNCMSKCTRNFYEEPVHIRNVKLEAAQKAYDAVMEKLAVPEKTDGRKAAVIGGGPSGMAAAYFLARGGADVTVFEKENALGGVVAHVIPDFRITKEAIEKDAAIIRKMGVKVELGREISSAKELKDQGFDAVFFAAGAGMPGVLKLEKGEPVDAAEFLKEFKAKDGNVELGKHVVVIGGGNTAMDTARAAKRTKGVEHVYLVYRRTKRYMPADAEELTLVQEEGIEFRELLSPVSMEDGKLLCRKMKLGAMDASGRASVEETGEMETVPADTVIAAVGERVDTALYQANGLPLDNRGKVVADSQTLEAVSGVYVIGDGLGGPATVVEGIRDAQKAAAAFLGKDDVSDMKKDGCEESCYSKKGILDSEKEPAKESGRCLNCAAVCENCTDVCPNRANIAVKVPGMAMRQIVHVDYMCNECGNCKTFCPYSSAPYKDKFTLFADETDMGDSENNGFVVLDREEKRVKVRLFGEPVEILLEDENPAVPAGLRKIMDAVISDYGYMIP

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|323090|-1|3638236-3641260

Note:

None




Candidate 31 in blautia CP039126

Seq (len = 178):

KKITNYGNMHIRFPLKNITKDTGRRGDIFCPGERHKWEDIEMSVVKELIRTEENGKISFGNYELAAKSKLSDFEHDGDMYKVKTYNEITKLERNGMFVYESVPGTAVLDLDVMEDGMSFLVEGPNDAQITVELEEDTEYAITIDGVNAGQMKTNLGGKLSFSVELEQSEQVSVNIKKL

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|314661|-1|3869292-3869826

Note:

None




Candidate 32 in blautia CP039126

Seq (len = 794):

GGKGMFQVVKRDGEIAEFRLDKIAEAVKKAFDATENEYSSDMLDLLALRVTSDFQKKIVKGKVSVEDIQDSVENVLIQAGYSDVAKSYILYRKQREKIRNMKSTILDYKEIVNSYVKVEDWRVKENSTVTYSVGGLILSNSGAVTANYWLSEIYDTEIAEAHRNADIHIHDLSMLTGYCAGWSLKQLIKEGLGGIEGKITSSPAKHLSVLCNQMVNFLGIMQNEWAGAQAFSSFDTYLAPFVKADSLSYPEVKKCVESFIYGVNTPSRWGTQAPFSNITLDWTVPNDLAELPAIVGGKEMSFKYKDCKKEMDMVNKAFIETMIEGDANGRGFQYPIPTYSITRDFDWSDTENNKLLFEMTSKYGTPYFSNYINSDMEPSDVRSMCCRLRLDLRELRKKTGGFFGSGESTGSVGVVTINMPRIAYMAEDEDDFFRRLDHMMDISARSLKIKRDVITKLLDEGLYPYTKRYLGSFENHFSTIGLLGMNEAGLNARWLKCDMSDERTQEFSKRVLNHMRERLKDYQEEYGDLYNLEATPAESTSYRLAKHDRKRWPDIRTAGNEGDTPYYTNSSHLPVDYTADIFDALDIQDELQTLYTSGTVFHAFLGEKLPDWKAAAALVRKIAQNYRLPYYTLSPTYSVCKDHGYLSGEHFVCPKCGKKAEVYSRITGYYRPVQNWNDGKSQEYKNRTVYDIAHSDFKIQTQMTAAPESNVRIQESDAGQVTAKYLFTTETCPNCKIAKQMLEGEDYELVDAEKNPELARKFGVMQAPTLIVINGEETKKYVNASNIQRYVDED

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|289400|-1|4526723-4529105

Note:

None




Candidate 33 in blautia CP039126

Seq (len = 417):

GTGQMRKKPELLIPASSLEVLKIAVIYGADAVYIGGEVFGLRAKARNFSMEDMAEGISFAHRYGVKVYVTANILAHNRDLEGVREYFEELKKIKPDALIISDPGVFMIAKEVCPEIERHISTQANNTNYGTYRFWHELGAKRVVCARELSLEEIREIRANIPRDMEIETFIHGAMCISYSGRCLLSNFFTGRDANQGACTHPCRWKYSIVEETRPGEYMPVYENERGTYIFNSKDLCMIEHMDDILTAGIDSLKIEGRMKTALYVATVARTYRKAIDDYLDSPELYQKNMPWYREQIMGCTYRQFTTGFFYGKPDETAQIYDSNTYAKDYTYLGYLEDKTPEGLYRITQRNKFLVGETLEAMKPDGENRPVTVKAIYDEEGNSCESAPHPQQILYVDLGEGLELYDILRRKEAVPEL

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|273396|-1|4945925-4947176

Note:

None




Candidate 34 in blautia CP039126

Seq (len = 709):

GKEKHMSEYTNVSEIFGEDVFNDTVMQQRLPKKVYKDLKHAILEGKELSPEMADVIAHEMKEWAIEKGATHYTHWFQPLTGVTAEKHDSFITAPLPSGKVLMSFSGKELIKGEPDASSFPSGGLRATFEARGYTVWDCTSPAFVRHDAAGATLCIPTAFCSYTGEALDQKTPLLRSMQAINKQALRLIRLFGDTTAKKVTPSVGAEQEYFLVSDKNFMQRKDLTFTGRTLFGAMPPKGQEMDDHYLGTIRQKISAYMKHVNEELWKLGVTSKTQHNEAAPAQHELAPIYAEVNVEADHNQIIMQTLKRIASQHGMKCLLHEKPFAGVNGSGKHNNWSLTTDTGVNLLDPGITPHQNIQFLLVLSCVLKAVDRHAALLRESAADVGNDHRLGANEAPPAIISVFLGDQLTDVMNQLITTGMADHSIKSEMLETGVKSIPEFMRDTTDRNRTSPFAFTGNKFEFRMVGARDSIAPANMVLNTIVAQSFKEACDVLEKAEDFDMAVHDLIKKNFTKHQRIVFNGNGYSEEWVEEAAKRGLPNIGCMVEAVEALTYEESVSLFEEFGVFTKAELESRKEIKYETYSKAINIEARTMIDVASKQIIPAVIKYTKNLADSVNAVVSAGILDVDVQTELLRDTSALLKDTRDALNHLKDVAKTAAVMEEGKERAFYYREKVMPAMEALRRPVDELEMIVDKEIWPMPSYGDLLFDV

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|268591|-1|5072945-5075072

Note:

None




Candidate 35 in blautia CP039126

Seq (len = 332):

PQEGGIILIDTKYTYAVARIRALETALFTSATLDQLMACQTEEQCLQLLQEKGWGGADTPVNAEAILTREQEKIWENIKDLGVDMSVFDVLSYPNMFHNLKAAIKDVCTEENGKTMNIYYDDTAVSPDEMLEIVRSKDFSRLPKYMAGAAKEAYETLLHTRDGQLCDVIVDKAALEAIYAAGKEAKDSIIKDYAESTVAIADIKIAVRSQKTAKNMDFMKRAMVECESLSVAQLSKAAVNGIDAIVEYLSGTAYAEGGKAIAESMSAFERWCDNRMMQTMQPQKYQSFSVGPLVAYVLARENEIKTVRIILSGKRSGLSDDSIRERVREMYV

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|25227|1|654529-655525

Note:

None




Candidate 36 in blautia CP039126

Seq (len = 163):

GGNLFMSQLGIVYALLGAALAVLLAGAGSSIGVGIAGQAAAGVVTEDPSKFAKVLIMQLLPGTQGIYGLLVGFITLSKIGLLGGGMLDLTPQQGLLVLAACLPIGIVGLISGKYQGMTSAAAIGIVAKKPEQFGKAMLFPAMVETYAILALLISILSVTNLSF

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|25168|1|653358-653847

Note:

None




Candidate 37 in blautia CP039126

Seq (len = 373):

DSMRAIGIILAGGNNNKMRELSQKRAIAAMPIAGSYRSIDFALSNMSNSHIQKVAVLTQYNARSLNEHLSSSKWWDFGRKQGGLYTFTPTITADNSFWYRGTADAMIQNLNFLKSSHEPYVVIASGDGVYKLDFNKVLEYHIAKRADITVVCTDVYGDDTTRFGCLKMNEDSRIEEFEEKPMVTRTNTVSTGIYVIRRRQLIELLEKCAQEDRYDFVKDILIRYKNLKRIYGYKINTYWSNISTVESYYKTNMDFLNPKVRDYFFNQYPGVQSKIDDLPPAKYNPGSDVRNSLVSSGCIINGQVENSVLFKKVFVGNNCVIKNSIILNDVYLGDNTHIENCIVESRDTIRANSYYCGEDGIKIVVEKNERYVL

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

blautia|CP039126|246917|-1|5623200-5624319

Note:

None




Candidate 38 in blautia CP039126

Seq (len = 64):

LNSRGKTGKGDKMNEDMSVFKSYLRRLLQDLKDLKEAIKSKEYDKAENMVDKLIDDTQKGIEDD

Score 3.0

score spec = 0.5; score region = 1; score transkriptom = 1.0; score RNAcode = 0.5

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|144919|1|3908784-3908976

Note:

None




Candidate 39 in blautia CP039126

Seq (len = 124):

IPSFSDCREWKTKKKTDNILMSYSRRCKDMLRMDLQFFAHKKGVGSTKNGRDSESKRLGAKRADGQFVKAGNILYRQRGTKIHPGVNVGRGGDDTLFALVDGVVRFERKGRDKKQVSVVPVTAE

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|107955|1|2814571-2814943

Note:

None




Candidate 40 in blautia CP039126

Seq (len = 370):

LRRFQNMSELSFEQMLDESFKTIRNGEVVEGTIIGVKEDEIILNIGYKADGIITRNEYSNDSNLDLTTVVSVGDTMEAKVLKVNDGEGQVLLTYKRLAAEKGNKRLEEAFENKEVLTAKVTQVLDGGLSVVLDEARVFIPASLVSDSYEKDLTKYQDQEIEFVITEFNPRRRRIIGDRKQLLMAKKAEMQKELFERIHPGDVVEGTIKNVTDFGAFIDLGGADGLLHISEMSWGRVENPKKVFKAGESIKVLIKDINGDKIALSLKFEDQNPWLDAAEKYAAGNIVEGRIARMTDFGAFIELEPGVDALLHVSQISRAHVDKPSDVLSVGQIVTAKVVDFNGEEKKISLSMKALEPASEDREEDAYDTEE

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

blautia|CP039126|101603|1|2646212-2647322

Note:

None




Candidate 41 in bact CP040530

Seq (len = 282):

RKNKMSRTNFDTLLEAGCHFGHLKRKWNPAMAPYIFMERNGIHIIDLHKTVAKVDEAAEALKQIAKSGKKVLFVATKKQAKQVVAEKAQSVNMPYVIERWPGGMLTNFPTIRKAVKKMATIDKLTNDGTYSNLSKREVLQISRQRAKLDKTLGSIADLTRLPSALFVIDVMKENIAVREANRLGIPVFGIVDTNSDPTNVDFVIPANDDATKSVEVILDACCAAMIEGLEERKAEKIDMEAAGEAPANKGKKKSVKARLDKSDEEAINAAKAAAFIKEDEEA

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

bact|CP040530|98471|1|2351334-2352180

Note:

None




Candidate 42 in bact CP040530

Seq (len = 685):

KTNLLYNMKVTKYLPILAVCLMTTGCNSKKEAVLTSGIDLANLDTTAMPGTSFYQYACGGWIESHPLTDEYSRFGSFDMLHEKSREQLKELIAELAAKKDNAPGSAAQKVGDLYNIAMDSVKLNKEGAAPIKEEMAAIDALKDKEEIYTYIAESQKKGIRPYFTMFVSADDMNSSMNMVQTYQGGLGMGQRDYYLENDEQTKSIRDKYKEHLVKMFQLAGYDEATAQKAMVAVMNIETRLAKAARSQVELRDPHANYNKMDMETLKKNFPTFNWDAYFTTSGLNDLKEVNIGQPAAMKEVADVINTVPLEDQKFYLQWNLIDAAASFLSDDFVAQNFDFYSRTMSGKKEMQPRWKRAVSTVDGSLGEVVGQMYVEKYFPAAAKERMVGLVKNLQTSLGERIKALEWMSEPTKVKALEKLATFHVKIGYPDKWKDYSALEIKDDSYWANIERASQWDFNDMIAKAGKPVDKDEWLMTPQTVNAYYNPTTNEICFPAAILQAPFFDMNADDAMNYGAIGVVIGHEMTHGFDDQGRQYDKDGNLKDWWTEEDAKKFEERAQVMVNFFDSIEVAPGVHANGELTLGENIADHGGLQVSFAAFKKAMETAPLEVVDGFTPEQRFFLAYANVWAGHIRPEEILRLTKLDPHSLGKWRVDGALPHIQNWYEAFNITEHDPMFVAKDKRVSIW

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

bact|CP040530|94391|1|2261987-2264042

Note:

None




Candidate 43 in bact CP040530

Seq (len = 176):

NREIMRKEDKNSIIEQIAATVKEYGHFYLVDVTAMNATATSALRRDCFKSDIKLMVVKNTLLHKALESLEEDFSPLYGSLKGTTAVMFCNTANVPAKLIKDKAKDGIPGLKAAYAEESFYVGADQLDALVAIKSKNEVIADIVALLQSPAKNVISALQSGGNTLHGVLKTLGERPE

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|495348|-1|694023-694551

Note:

None




Candidate 44 in bact CP040530

Seq (len = 856):

PSIVNCQLSIVNFMKKFLPDLIAILAFIILSFAYFFPADIESRILFQHDTVAGVGAGQEAQEYLERTGERTRWTNSLFGGMPTYQMSPSYDSTKPLKWIENIYHLYLPSYVVLTFIMMLGFYILLRAFGLSVWLSALGGIIWAFSSYFFILISAGHIWKFVTLAYIPPTIAGIVLAYRKKYLLGGIVTALFIALQIQSNHIQMSYYFMFVILFFVGAYFEDAYKKKELPHFFKASAVLALAAMIGVCANLSNLYHTYEYSKETMRGKSELKQEGPAANQTSSGLDRNYITNWSYGIGETLTLLVPNVKGGASVPLSKNETAMAKANPMYSNIYSQLTQYFGDQPMTSGPVYVGAFVLFLFILGCFIVKGPLKWALLGATIFSILLSWGKNFMGLTDFFIDYVPMYNKFRAVSSILVIAEFTIPLLAVFALKEVLAKPEILKLKENRTGVIITLVLTAGVSLILAVAPGVFFSSYIPAQEMAALQQGLPAEYLSPIITNLAEMRKAMLTSDAWRSFFIIVVGCFLLFLYQQKKLKASFTMTGIVLLCLIDMWTVNKRYLNDEQFVSKSNQTGAFVKTQTDEIILQDTALNYRVLNFVGFPGNTFNENNTSYWHKSVGGYHAAKLRRYQEMIDHHITPEMKDAYQEVAGAGGAMDSVDASKFRVLNMLNTKYFIFPAGQQGQTVPVENPYAYGNAWFVDKVQYVNNANEEIDALNDILPTETAVVDAKFKDQLKGVTKGYKDSLSTIRLTSYEPNRLVYETSSAKDGVAVFSEIYYPGWQAKIDGQPVDIARADYILRVMNVPAGQHTIEMWFDPQSLHVTESIAYASLALLLIGVMILIWFSKKKLITPKKKEAENS

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|491620|-1|770371-772939

Note:

None




Candidate 45 in bact CP040530

Seq (len = 537):

RAGNGDAAGPSFKRMKGEREMLEPALKEQLKGIFAGLEADFTFDISVSASHESRAELLELLSDVAECSDHITCMVNEGSGLKFTIGKNGKPTEITFRAIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKALKGPIHLVTYVSLTCTNCPDVVQALNAMTTLNPSITHEMVDGALYQDEVDALKIQGVPSVFADGKLLHVGRGEFGELLAKLEAQYGIDETKVETEVKEYDVIVAGGGPAGVSAAIYSARKGLRVAIVAERVGGQVKETVGIENLISVPETTGSELADNLKTHLLRYPVDLLEQRKIEKVELAGKDKLVTTSVGEKFIAPALIIATGASWRKLNVPGENDYIGRGVAFCPHCDGPFYKGKQVAVVGGGNSGIEAAIDLAGICSKVTVFEFMDELKADNVLQERLKSLPNVEVFVSSQTTEVIGNGDKLTALRIKDRKTEEERLVELDGVFVQIGLSANSSVFRDIVETNRPGEIVIDAHCRTNVTGIYAAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGLIV

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|490467|-1|794586-796197

Note:

None




Candidate 46 in bact CP040530

Seq (len = 664):

IVNNIMIKIDSKIPEGPVAEKWTNYKAHQKLVNPANKRRLDIIVVGTGLAGASAAASLGEMGFRVFNFCIQDSPRRAHSIAAQGGINAAKNYQNDGDSVYRLFYDTVKGGDYRAREANVYRLAEVSNAIIDQCVAQGVPFAREYGGTLDNRSFGGAQVSRTFYAKGQTGQQLLLGAYSALSRQVNVGTVKLFTRYEMQDVVIIDGRARGIIAKNLITGELERFAAHAVVIATGGYGNAYFLSTNAMGCNCTAAISCYRKGAVFANPAYVQIHPTCIPVHGDKQSKLTLMSESLRNDGRIWVPKKKEDAIKLQKGEIKGSDIPEEDRDYYLERRYPAFGNLVPRDVASRAAKERCDAGFGVNNTGLAVFLDFSEAINRLGIDVVLQRYGNLFDMYEEITDVNPGELAKEISGVKYYNPMMIYPAIHYTMGGIWVDYELQTTIKGLFAIGECNFSDHGANRLGASALMQGLADGYFVLPYTIQNYLADQITVPRFSTDLPEFAEAEKAVQAKIDKFMSIQGKESVDSIHKKLGHIMWEYVGMGRTAEGLKKGIAELKAVRKEFETNLFIPGSKEGMNVELDKAIRLYDFITMGELVAYDALNRNESCGGHFREEYQTEEGEAKRDDENFFYVACWEYQGDDEKAPVLIKEPLVYEAIKVQTRNYKS

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation --->

ID:

bact|CP040530|46358|1|1176637-1178629

Note:

None




Candidate 47 in bact CP040530

Seq (len = 466):

IMKFDMKKQILYMLCATALLSSCHIYKSYDRPEDITASGLYRDPAADNDTLASDTTNFGNLPWREVFTDPQLQSLIEQGLKQNTDLLSAALNVKAAEASLMSARLAYAPSIGLSPQGTISSFDKNAATKTYSLPVTASWQVDLFGQLLNSKRNAQVTLKQTKAYRQAVQTQVIANIANMYYTLLMLDRQLEITQATAEVLKRNAETVQALSERSTYTSAALAQSKAAYAQVVASIPDIEQSIRETENALSTFLGEAPHAIKRGVLEAQALPEELSAGIPLQLLSNRPDVKAAEMSLASCYYNTNSARAAFYPQITLSGSAGWTNSAGSAIINPGKLLASAIGSLTQPLFYRGTNIARLKAAKAQEEQAKLSFQQTLYNAGSEVSNALSLYQNTSKKAESRQMQVESAKKASEDTKELFNLGTSTYLEVLSAQQSYLSAQISQVSDCFDKMQAVVSLYQALGGGRED

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|455958|-1|1598071-1599469

Note:

None




Candidate 48 in bact CP040530

Seq (len = 773):

NDMINKKIFFSLLLLAAGFLSAAAQKSPQDMDRFIDALMKKMTVEEKIGQLNLPVTGEITTGQAKSSDIAAKIKRGEVGGLFNLKGVEKIRDVQKQAVEQSRLGIPLLFGMDVIHGYETMFPIPLGLSCTWDMTAIEESARIAAIEASADGISWTFSPMVDISRDPRWGRVSEGSGEDPFLGAMIAEAMVLGYQGKDMQRNDEIMACVKHFALYGAGEGGRDYNTVDMSRQRMFNEYMLPYEAAVEAGVGSVMASFNEVDGVPATANKWLMTDVLRGQWGFNGFVVTDYTGISEMIDHGIGDLQTVSARAINAGVDMDMVSEGFVSTLKKSIQEGKVSMETLNTACRRILEAKYKLGLFDNPYKYCDLKRPARDIFTKAHRDAARRIAAESFVLLKNDNVTLRPGTPAEPLLPFNPKGNIAVIGPLADSRTNMPGTWSVAAVLDRCPSLVEGLKEMTAGKANILYAKGSNLISDASYEERATMFGRSLNRDNRTDEQLLNEALTVANQSDIIIAALGESSEMSGESSSRTDLNIPDVQQNLLKELLKTGKPVVLVLFTGRPLTLTWEQEHVPAILNVWFGGSEAAYAIGDALFGYVNPGGKLTMSFPKNVGQIPLYYAHKNTGRPLAQGKWFEKFRSNYLDVDNEPLYPFGYGLSYTTFSYGDIDLSRSTIDMTGELTAAVMVTNTGTWPGSEVVQLYIRDLVGSTTRPVKELKGFQKIFLEPGQSEIVRFKIAPEMLRYYNYDLQLVAEPGEFEVMIGTNSRDVKSARFTLK

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|442478|-1|1918037-1920356

Note:

None




Candidate 49 in bact CP040530

Seq (len = 556):

LCNNVMVERFLAQTSFASQEDFIKNLKINVPENFNFGYDVVDAWAAEQPDKNALLWTNDQGESRQFSFADMKRYTDMTASYFQSLGIGRGDMVMLILKRRYEFWYSTIALHKLGATVIPATHLLTKKDIIYRCNAADIKMIVAAGEGIILQHIKDALPECPSVEKLVSVGPEVPEGFEDFHQGIDNAAPFIRPRHANTNDDISLMYFTSGTTGEPKMVAHDFTYPLGHIVTGSFWHNLDENSLHLTIADTGWGKAVWGKLYGQWIAGANIFVYDHEKFTPAAILEKIQEYQVTSLCAPPTIFRFLIHEDLTKYDLSSLRYCTIAGEALNPAVFETFKKLTGIKLMEGFGQTETTLTVATMPWMEPKPGSMGLPNPQYDVDLIDSEGRSVEAGEQGQIVIRTSKGKPLGLFKEYYRDAERTHEAWHDGIYYTGDVAWKDEDGYLWFVGRADDVIKSSGYRIGPFEVESALMTHPAVIECAITGVPDEIRGQVVKATIVLSKDYKARAGEELIKELQNHVKKVTAPYKYPRVIEFVDELPKTISGKIRRVEIRENDEK

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|432373|-1|2176688-2178356

Note:

None




Candidate 50 in bact CP040530

Seq (len = 527):

KEIMKGLLTSLITVLTFTGLQAQSLPTAPKLVVGLTIDQLRTDYLEAFSSLYGERGFKRLWKEGRVFHNAEYTFSGVDRASAMAAIYSGSTPSVNGIISNRWMDVATLRPVNSTDDAAFMGYYTDQTCAPTKLLTSTIADELKIATQGKGIVYAIAPFCDAAIFAAGHAGNGAFWINPTTGKWSGTTYYGEFPWWASQYNDRQAIDSRISSVTWEPVFPRGMYTFLPDWRDVVFKYKFDDDRNNKFRRFITSPFVNDEVNALAEEAIGKGSVGMDDITDLLALTYYAGNYAHKSVQECAMEIQDTYVRLDRSIANLLDLLDKKVGLQNVLIFVTSTGYTDSESTDSGLYKIPTGEFHLNRCTALLNMFLMATYGEGKYVEAYHDQQIYLNHKLLEQKQLNLTEVQEKSADFLMQFSGVNEAYSAHRLLLGSWTPEIYRIRNGYHRKRSGDLVIDVLPGWTIVSENGNENKVVRHSYIPAPLIFMGHSVKPAIIQTPVTIDHIAPTLAHFMRIRAPNASSSAPITDLR

Score 3.0

score spec = 1; score region = 0; score transkriptom = 1.0; score RNAcode = 1.0

see in UCSC-Genome-Browser

orientation <---

ID:

bact|CP040530|398139|-1|3056369-3057950

Note:

None